[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86727.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->102 PF07372 * DUF1491 2e-05 36.6 %
:HMM:PFM   3->111 PF07372 * DUF1491 5.7e-37 53.9 102/104  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86727.2 GT:GENE AAK86727.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 911525..911881 GB:FROM 911525 GB:TO 911881 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86727.2 GB:DB_XREF GI:159139837 LENGTH 118 SQ:AASEQ MRLKSEMFVSALIRRVFAAGGFAAVEKKGAEAAGAIFVRQRLRDGRENLYGPAPQSFADDEDIMRAERRFETRLAGVEGEEIAALLERERRFDSDLWVVEIETDEIGTLLTLVDQPQA GT:EXON 1|1-118:0| SEG 16->35|vfaaggfaavekkgaeaaga| SEG 78->91|egeeiaallererr| RP:PFM:NREP 1 RP:PFM:REP 3->102|PF07372|2e-05|36.6|93/104|DUF1491| HM:PFM:NREP 1 HM:PFM:REP 3->111|PF07372|5.7e-37|53.9|102/104|DUF1491| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1--------111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,117-119| PSIPRED cccHHHHHHHHHHHHHHcccEEHHHHHcccccccEEEEEEEcccccEEEEEccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccc //