[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86730.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->46 PF04640 * PLATZ 0.00068 28.6 42/72  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86730.1 GT:GENE AAK86730.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 913430..913624 GB:FROM 913430 GB:TO 913624 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86730.1 GB:DB_XREF GI:15155922 LENGTH 64 SQ:AASEQ MSMAEIIAIGDARRSLRPAGVVAHVIGPAKVVLFTGVRYEKRDTEPTGKVAHKGKSAAETALKS GT:EXON 1|1-64:0| HM:PFM:NREP 1 HM:PFM:REP 4->46|PF04640|0.00068|28.6|42/72|PLATZ| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 48-54, 58-60, 63-64| PSIPRED cccHHEEEEcccccccccccHHHHHcccEEEEEEcccccccccccccccHHHccccHHHHHccc //