[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86731.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  56/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.65.1
:195 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   81->160 2p3yA PDBj 9e-09 35.0 %
:RPS:SCOP  71->168 2p3yA1  e.65.1.1 * 1e-17 27.6 %
:RPS:PFM   97->168 PF06742 * DUF1214 2e-08 43.7 %
:HMM:PFM   94->172 PF06742 * DUF1214 1.5e-18 35.9 78/87  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86731.1 GT:GENE AAK86731.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(914186..914773) GB:FROM 914186 GB:TO 914773 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86731.1 GB:DB_XREF GI:15155923 LENGTH 195 SQ:AASEQ MFRVPFLVGIALLIAFGGGIAATMAALEATSGFGSIRIGSWDAFPEAQTIEADPYAKSHRADAGKLLYGTAEGLSFTAAVDSDGQRLSGECRYRLAGAVPPARFWTLYTADQQGNVLAEDAGRPFALNSRTLLRSADGGIDITIAPDAQTYNWLAVPQGQTFKLVMTLLDTPVAGSSGLIDISMPQIRKLGCGNA GT:EXON 1|1-195:0| TM:NTM 1 TM:REGION 4->26| SEG 7->22|lvgialliafgggiaa| BL:PDB:NREP 1 BL:PDB:REP 81->160|2p3yA|9e-09|35.0|80/447| RP:PFM:NREP 1 RP:PFM:REP 97->168|PF06742|2e-08|43.7|71/87|DUF1214| HM:PFM:NREP 1 HM:PFM:REP 94->172|PF06742|1.5e-18|35.9|78/87|DUF1214| RP:SCP:NREP 1 RP:SCP:REP 71->168|2p3yA1|1e-17|27.6|98/461|e.65.1.1| OP:NHOMO 58 OP:NHOMOORG 56 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111-11111111113-11111111111111-11---------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 41.0 SQ:SECSTR ################################################################################cTTcccccTTccEEEcccccEEEEEEEEEEETTTccccccccccEEETTccccccTTccEEEEEccTTcTTccccccTTc################################### DISOP:02AL 193-195| PSIPRED cEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccHHHHHHHHHHHHccccccccEEEEEEEcccccEEcccccEEEccccccccEEEEEEEccccccccccccccccccccccEEcccccEEEEEEcccccccEEEEcccccEEEEEEEEcccHHHHccccccccccEEEcccccc //