[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86735.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:481 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86735.1 GT:GENE AAK86735.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(918455..919900) GB:FROM 918455 GB:TO 919900 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86735.1 GB:DB_XREF GI:15155927 LENGTH 481 SQ:AASEQ MSNAREERRAIAAVLVAGLGFVPATAHAQDPMLLIDEPGFELRLHFQAGVNAVAEQNLFWNFADTFAPSAGFDSDTRWLEGYLMPGIGFTVDAGDVLEVYGKLSVVASGTLGTDAFDAGGTGAITLEDGYLGLRSKAKTGPFFDMSLGPRPFQTGTGMLIANGGSSGFERGALKLGPRKAWEQAAILRLGVDDLTATAFFIDANELSDKDSGTKIVGADLRYEVDKGRYAGVTFGHVPESGSPYPRAAAGGIGAPVIVPGAREGLSFVNAYARSNPFEGQLSGFFIGGDIAYQWNPDIDLRAWGGRTQIGYAFEEFSWTPTIAYSYQTFSGDDPSTSRLERFDPLYYEGNPSAWSTGTKSSMMFLNSNVNAHQLSLQVKPTQADTWTLRYAHIRANELNSPIQFGQGTRLDEIDGTPTPVAGVGNRHLADDIYLEYSRVINPNTFLTAGVSISFPGKGMESMTAENSPTWLGGFVNVIVNF GT:EXON 1|1-481:0| SEG 109->123|gtlgtdafdaggtga| SEG 247->261|aaaggigapvivpga| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------11-11111---------------11----------------------1--------------1----------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccEEEEEEEccEEEEEccccccccccccccccccccccccccEEEEEcccEEEEEEEEEEEEEEEEEEEEccccccccccccccHHHEEHHHHEEEccccccccEEEEEccEEEEEccEEEEEEcccccccccEEEccccEEEcEEEEEEEccccEEEEEEEEccccccccccccEEEEEEEEEEEcccccccEEEEEEccccccccccccccccccEEEcccccEEEEEEEEcccccccccccccEEEEEEEEEEccccEEEEEEEEEcccHHHHccccccEEEEEEEEEEccccccccccccccccccccccccccccccccEEEEcccEEEEEEEEEcccccccEEEEccEEEccHHccHHHHcccccccccccccccccccccccccEEEEEEEEEEEcHHHHHHHHHEEEEcccHHHHHcccccccEEcEEEEEEEEc //