[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86740.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->52 2k29A PDBj 1e-05 39.1 %
:RPS:PFM   5->55 PF04221 * RelB 1e-07 51.0 %
:HMM:PFM   4->70 PF04221 * RelB 4e-25 47.8 67/83  
:BLT:SWISS 1->55 DINJ_ECOLI 4e-15 60.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86740.1 GT:GENE AAK86740.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(924473..924748) GB:FROM 924473 GB:TO 924748 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86740.1 GB:DB_XREF GI:15155934 LENGTH 91 SQ:AASEQ MTANAYVRARIDQTLKDDATAVLDRLGLTVSDVMRMMLTRIAREKALPIELTQPNAETLAAIEEARAIAAAGRNRFGTSEALFEALDAGKR GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->55|DINJ_ECOLI|4e-15|60.0|55/86| SEG 56->71|aetlaaieearaiaaa| BL:PDB:NREP 1 BL:PDB:REP 7->52|2k29A|1e-05|39.1|46/50| RP:PFM:NREP 1 RP:PFM:REP 5->55|PF04221|1e-07|51.0|51/81|RelB| HM:PFM:NREP 1 HM:PFM:REP 4->70|PF04221|4e-25|47.8|67/83|RelB| OP:NHOMO 74 OP:NHOMOORG 71 OP:PATTERN -------------------------------------------------------------------- 1-----------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11-2-----1---------1---1-11---1-1121---1--111--11--11-------------------------------------------1----1111-11--------1---------------------------------1------------1---2--1--------------------------------------------------------------------------------------------------------------------------------111-1---11-11111--1111--11111-------1---1-1-1-1---1------1---1--1-------------1---------------------------------------------------------1-----------------------------------11-1----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 46 STR:RPRED 50.5 SQ:SECSTR ######ccccccHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHcccccccc####################################### DISOP:02AL 1-3, 89-91| PSIPRED cccccEEEEEccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccc //