[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86753.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  453/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->111 1yyvB PDBj 3e-20 47.5 %
:RPS:PDB   12->114 3echB PDBj 4e-09 11.7 %
:RPS:SCOP  1->113 1yyvA1  a.4.5.69 * 3e-27 42.9 %
:HMM:SCOP  5->120 2f2eA1 a.4.5.69 * 4.4e-32 41.2 %
:RPS:PFM   20->109 PF01638 * HxlR 2e-21 50.0 %
:HMM:PFM   21->108 PF01638 * HxlR 2.2e-30 47.7 88/91  
:BLT:SWISS 6->121 YTFH_SHIFL 6e-27 49.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86753.2 GT:GENE AAK86753.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(936925..937293) GB:FROM 936925 GB:TO 937293 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86753.2 GB:DB_XREF GI:159139853 LENGTH 122 SQ:AASEQ MEHIYDVYEDRCPTRMVLDRIADKWALLILDKLRVDAVRFNLLRREIKGISQKVLSQTLKKLERDGLISRQAFPTVPVTVEYSLTPLGRTLTETVAALAHWAEGNIEAVMAAQRAYDERVAA GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 6->121|YTFH_SHIFL|6e-27|49.6|113/126| BL:PDB:NREP 1 BL:PDB:REP 6->111|1yyvB|3e-20|47.5|101/107| RP:PDB:NREP 1 RP:PDB:REP 12->114|3echB|4e-09|11.7|103/135| RP:PFM:NREP 1 RP:PFM:REP 20->109|PF01638|2e-21|50.0|90/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 21->108|PF01638|2.2e-30|47.7|88/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 1->113|1yyvA1|3e-27|42.9|112/114|a.4.5.69| HM:SCP:REP 5->120|2f2eA1|4.4e-32|41.2|114/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1110 OP:NHOMOORG 479 OP:PATTERN 11-----------11---------111211-1--1----1---681-2--221--------1------ 2---A--2222---1---------15-----1-2225242-94C23-1111-311--2--211-7-4A95--111-11--131-1-1-1211-12------9---R4A-1----------------------------------214-1322---111-----11-21221---------------11--11-599999A5935A8789455556818--15153211112AF---------------1---12-3-11-----431111322-1-233---1----12------------1111-1111111-11---11111--6F111211113--5111--121----1---341------1---2-212-1133------53454--13212-----------4-23242327171-86646414662342411-141--1-1211111111-324---2-----------------------------2-2112-111-323152-22221131222222313--21----31-1--31-11--1--1112----------1-1-111-1111-31111-11---11111---22-13-11-2121-1-1--------2---221--2--1----------1-----------1-------------2137-3-1111111111-111111111111111111123275--11111--1---11111131111111--211111111111---------1111--422---211-----1--155666-2----1----1113------123--------------111-11----32121211111111---1----------------1----1-------------------------------12 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3-----------------1-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 122 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHGGGHHHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHEHHHHHHHccHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHH DISOP:02AL 1-2,117-123| PSIPRED ccEEEccccccccHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //