[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86756.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->106 PF02321 * OEP 9.2e-05 19.6 56/188  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86756.2 GT:GENE AAK86756.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 940187..940711 GB:FROM 940187 GB:TO 940711 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86756.2 GB:DB_XREF GI:159140667 LENGTH 174 SQ:AASEQ MTSSHTYDPALYGAWPETPAYADDDMPEAAPEIKSRADRLAAEDAARNGNLRQLLNELTEEMRQQFSMYRNMREAGEAGLLPDADDAQAKQARADVKIATDQLSLIVRTLERIDALQRVLAQERQALMAEDETETEDYEAAVAHFLGRIDDLAEQKCRERLEAIAALGTSVGSG GT:EXON 1|1-174:0| SEG 36->47|radrlaaedaar| SEG 83->95|daddaqakqarad| SEG 129->143|aedetetedyeaava| HM:PFM:NREP 1 HM:PFM:REP 50->106|PF02321|9.2e-05|19.6|56/188|OEP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,39-39,173-175| PSIPRED cccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //