[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86761.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   48->74 3d6lA PDBj 8e-04 60.9 %
:HMM:PFM   10->66 PF02592 * DUF165 0.00041 17.9 56/145  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86761.1 GT:GENE AAK86761.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 945062..945382 GB:FROM 945062 GB:TO 945382 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86761.1 GB:DB_XREF GI:15155959 LENGTH 106 SQ:AASEQ MSEFANEAGIWAARITGAIAGAGVSLVYLLPKSKREAASRFVTGVSCGMIFGGPIGLWIVQQLDIAGALSGREIMVAGSAAASMGAWWGLGVLVRIADRYGTRPRA GT:EXON 1|1-106:0| TM:NTM 3 TM:REGION 10->32| TM:REGION 42->64| TM:REGION 76->98| SEG 8->23|agiwaaritgaiagag| SEG 77->91|agsaaasmgawwglg| BL:PDB:NREP 1 BL:PDB:REP 48->74|3d6lA|8e-04|60.9|23/133| HM:PFM:NREP 1 HM:PFM:REP 10->66|PF02592|0.00041|17.9|56/145|DUF165| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 102-106| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccc //