[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86771.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->95 PF12050 * DUF3532 1e-06 40.3 %
:HMM:PFM   24->97 PF12050 * DUF3532 1.3e-26 44.4 72/74  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86771.1 GT:GENE AAK86771.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(950974..951378) GB:FROM 950974 GB:TO 951378 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86771.1 GB:DB_XREF GI:15155969 LENGTH 134 SQ:AASEQ MVDVSDMELAAAKERWQKERAGRPIPVSVRFEAASARVIVDFTNGACFMFPARALEGLQDATAEQLAEVELLGETGLHWENLDVDYTIAGLMNGIFGSRTFMEAQRKGGQSRSPAKTAASRANGAKGGRPRKMP GT:EXON 1|1-134:0| RP:PFM:NREP 1 RP:PFM:REP 27->95|PF12050|1e-06|40.3|67/73|DUF3532| HM:PFM:NREP 1 HM:PFM:REP 24->97|PF12050|1.3e-26|44.4|72/74|DUF3532| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------1-1----1---------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------11--1-----1---------------11111111---1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 102-134| PSIPRED cccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccccEEEccHHHHHHHHcccHHHHccEEEcccEEEccccccccccHHHHHHHHHccHHHHHHHHHccccccHHHHHHHHHHHHccccccccc //