[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86774.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  67/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:294 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->163 PF09931 * DUF2163 2e-37 51.6 %
:RPS:PFM   193->275 PF09356 * Phage_BR0599 1e-17 49.4 %
:HMM:PFM   1->163 PF09931 * DUF2163 1.6e-62 52.8 163/163  
:HMM:PFM   193->275 PF09356 * Phage_BR0599 5.4e-28 50.6 79/80  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86774.1 GT:GENE AAK86774.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 952990..953874 GB:FROM 952990 GB:TO 953874 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86774.1 GB:DB_XREF GI:15155974 LENGTH 294 SQ:AASEQ MKTLPASLADHLKADATTTCHCWRVTLKDGVVMGFTDHDETLSFGGTSYLAASGFSASDSDSETGLGASAGEVAGGFSSEAIAEDDLAAGRFDGAKVELFLVNWQAPDEHVLLSLREIGEVTRAGGAFRAELRSIAHRLGQPQGRSYGRRCDAALGDGRCGVDLTRFTGHGSVAAVDVSGKLRVSGLDAFAEGFFSRGKLGFLTGSLAGKAFDLDGHERRDGGVLLSFWLTPDRMPSPGDRFSVTAGCDKSFATCKAKFGNHLNFRGFPHLPGADFAYSYASGGQSHDGGVLFP GT:EXON 1|1-294:0| SEG 51->62|aasgfsasdsds| RP:PFM:NREP 2 RP:PFM:REP 7->163|PF09931|2e-37|51.6|157/161|DUF2163| RP:PFM:REP 193->275|PF09356|1e-17|49.4|79/80|Phage_BR0599| HM:PFM:NREP 2 HM:PFM:REP 1->163|PF09931|1.6e-62|52.8|163/163|DUF2163| HM:PFM:REP 193->275|PF09356|5.4e-28|50.6|79/80|Phage_BR0599| OP:NHOMO 79 OP:NHOMOORG 68 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11---12211111-111-11-11--11111511--1--111--------111-11121212112----------------11111111------11---------1-11-11-1--------------------1-----------------------2---1----------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------ DISOP:02AL 1-4, 288-290| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEccEEEEccccccHHHHHHHHcccccccEEEEEEccHHccHHHHHccccccEEEEEEEEEccccccEEEEEEEEEEEEEccccEEEEEEccHHHHHcccccccccccccEEEEEcccEEEcccccEEEEEEEEEcccEEEEEEccccccccccccEEEEEcccccccEEEEEEEEEEcccEEEEEcccccHHHccccEEEEEEcccccHHHHHHHHccccccccccccccccEEEEEEcccccccccEEEc //