[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86775.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->134 2k1gA PDBj 2e-07 33.0 %
:RPS:SCOP  8->140 2evrA2  d.3.1.16 * 1e-13 18.8 %
:HMM:SCOP  1->143 2evrA2 d.3.1.16 * 1.8e-17 35.2 %
:HMM:PFM   17->137 PF00877 * NLPC_P60 5.4e-10 30.4 102/105  
:BLT:SWISS 12->141 PGDS_BACSU 3e-07 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86775.1 GT:GENE AAK86775.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 953871..954305 GB:FROM 953871 GB:TO 954305 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86775.1 GB:DB_XREF GI:15155975 LENGTH 144 SQ:AASEQ MSDTAQKVLAMAESWIGTPYRHQASLSGVGCDCLGLIRGIWRGLYGHEPELPPPYAPDWAERGGEDRLMAAAKRHFLTVPGMEEAQPGDLLLFRWRADAAAKHLGILAGPEHFIHAYEQAAVVRSALVPGWKRRIAGTFRFPDP GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 12->141|PGDS_BACSU|3e-07|36.4|110/413| BL:PDB:NREP 1 BL:PDB:REP 3->134|2k1gA|2e-07|33.0|112/129| HM:PFM:NREP 1 HM:PFM:REP 17->137|PF00877|5.4e-10|30.4|102/105|NLPC_P60| RP:SCP:NREP 1 RP:SCP:REP 8->140|2evrA2|1e-13|18.8|112/148|d.3.1.16| HM:SCP:REP 1->143|2evrA2|1.8e-17|35.2|122/0|d.3.1.16|1/1|Cysteine proteinases| OP:NHOMO 59 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------1----122111111111111111--11111511--1--111--------111-11121211112----------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 77.8 SQ:SECSTR ##cHHHHHHHHHHHHTTcccccccccTT#cccHHHHHHHHHHHTTcccc###cccHHHHGGGc#####EEEcGGGccT#########TEEEEEE##ETTTEEEEEEEEETTEEEEEETTTEEEEEETcHHHHHH########## DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHcccHHHHHHHHHHccccccHHHcccccEEEEccccccccEEEEEEEcccEEEEEcccccEEEEcccHHHHHHcEEEEEcccc //