[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86778.1
DDBJ      :             Conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86778.1 GT:GENE AAK86778.1 GT:PRODUCT Conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 958504..958758 GB:FROM 958504 GB:TO 958758 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein GB:PROTEIN_ID AAK86778.1 GB:DB_XREF GI:15155978 LENGTH 84 SQ:AASEQ MASPLIIATLAAGLSGFTAPEADLQGHYILAASDCGAAVARVVRETGGQLLSVYPSGDGQSCVVTVLVQGNGERPRKVTMRVPM GT:EXON 1|1-84:0| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHHHHHccccEEEEEEcccccEEEEEEEEEccccccEEEEEEEcc //