[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86797.2
DDBJ      :             molecular chaperone, Hsp70 family
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  365/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1d.179.1
:432 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->398 2v7yA PDBj 8e-13 27.0 %
:RPS:PDB   6->431 3d2fC PDBj 1e-26 18.8 %
:RPS:SCOP  5->176 1jceA1  c.55.1.1 * 2e-15 20.1 %
:RPS:SCOP  155->422 1dq8A4  d.179.1.1 * 9e-13 10.9 %
:HMM:SCOP  5->184 1dkgD1 c.55.1.1 * 5.8e-19 27.3 %
:HMM:SCOP  184->426 1dkgD2 c.55.1.1 * 5.1e-30 31.4 %
:RPS:PFM   8->420 PF00012 * HSP70 5e-13 29.7 %
:HMM:PFM   108->239 PF00012 * HSP70 7.1e-10 31.7 123/602  
:HMM:PFM   311->407 PF00012 * HSP70 8.7e-12 28.9 97/602  
:BLT:SWISS 38->423 YEGD_ECOLI 5e-34 27.2 %
:PROS 414->424|PS00639|THIOL_PROTEASE_HIS
:PROS 380->394|PS01036|HSP70_3

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86797.2 GT:GENE AAK86797.2 GT:PRODUCT molecular chaperone, Hsp70 family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(983084..984382) GB:FROM 983084 GB:TO 984382 GB:DIRECTION - GB:PRODUCT molecular chaperone, Hsp70 family GB:PROTEIN_ID AAK86797.2 GB:DB_XREF GI:159139867 LENGTH 432 SQ:AASEQ MTQKRALGLDFGTTNTVMALSDTGSASHSMRFTSSAGTDDSMRTALSFMKDAGLGAAALHVEAGQAAIRQFIDNAGDCRFLQSIKTFAASPLFQGTLIFAKRQSFEDLMEVFLRKLKTYAGSEWPGDVSTVIAGRPVRFAGSNPDETLALARYNEALTRAGFPEIHYVYEPVAAAYYFAQSLKKDANVLVADFGGGTTDYSLIRFETHAGKLSATPIGHSGVGVAGDHFDFRMIDNLVSPEIGKGSKFKSFDKVLDVPSGYYVNFGRWNQLSIFKTSKEFTDLKSLVRSALEPDKLELFIDLVEHDEGYPLYQAISATKMALSSAQEAEFNFSPLGKAGRKMVKRSDFNNWIADDLAKIEGALDEVLEKTKVAPEAIDKVFLTGGTSFVPAVRELFTRRFDADRIESGGELLSIAHGLAMIGESGDIQRWTA GT:EXON 1|1-432:0| BL:SWS:NREP 1 BL:SWS:REP 38->423|YEGD_ECOLI|5e-34|27.2|378/450| PROS 414->424|PS00639|THIOL_PROTEASE_HIS|PDOC00126| PROS 380->394|PS01036|HSP70_3|PDOC00269| BL:PDB:NREP 1 BL:PDB:REP 5->398|2v7yA|8e-13|27.0|318/504| RP:PDB:NREP 1 RP:PDB:REP 6->431|3d2fC|1e-26|18.8|352/627| RP:PFM:NREP 1 RP:PFM:REP 8->420|PF00012|5e-13|29.7|350/488|HSP70| HM:PFM:NREP 2 HM:PFM:REP 108->239|PF00012|7.1e-10|31.7|123/602|HSP70| HM:PFM:REP 311->407|PF00012|8.7e-12|28.9|97/602|HSP70| RP:SCP:NREP 2 RP:SCP:REP 5->176|1jceA1|2e-15|20.1|134/137|c.55.1.1| RP:SCP:REP 155->422|1dq8A4|9e-13|10.9|248/300|d.179.1.1| HM:SCP:REP 5->184|1dkgD1|5.8e-19|27.3|161/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 184->426|1dkgD2|5.1e-30|31.4|191/0|c.55.1.1|1/1|Actin-like ATPase domain| OP:NHOMO 378 OP:NHOMOORG 372 OP:PATTERN -------------------------------------------1111---1-1--------------- --1--11111111111111-1111-111111-11111---11111111-1111111----1-1-112--1-1111-11----------------------------11----------------------------1-1-----1-------------------------------------------1--1------------------1-------------1------11--------------------------------------1------------------------------------------------------------------11-------11--1---1111111-1-1-----11---1112-----111111---1--111111111111-11111111-11-11111111111111-1---11111-1111111111-111-111--------------------------------1--1----1111111111111211111111111111--111111--12111-11--1-11-----------11-1-1------1-----1-11--1-11111211----------------------------1111--1-2111111111111111111111---1---------11111111111111111-111111111111111111111111--11111-111111111111111--11--111111111111--------------11-1-------------------------1-11111111111111111----------11111111111111--1-1------------------------------111----------------------11-11-1------ ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 431 STR:RPRED 99.8 SQ:SECSTR #cccEcEEEEEcccEEEEEEEETTEEEEEccTTcccEEEccEEccEEEccccHHHHHGGcEEETHHHHHHTTTcGGGHHHTTccTTcTTHHHHHTTcccEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTccHHHHHHHHHHHHHTTHHHHTTcEEEEEEEHHHHHHHHHHccccccEEEEEEEEccccEEEEEEEEETTEEEEEEEEEEEEEcccEEETccHHHHHHHHHHHHHHcccccTcccGGGHHHHccccccHHHHHTcccGGGcTTcHHHHHHHHHHHHHHHHTcccEEEEEEHHHHHHHHHHHHHHHHccEEEEEEccccccEEEEEEHHHHHHHTHHHHTTTTHHHHHHHHHTTccGGGccEEEEEcGGGGcHHHHHHHHHHHTccEEccccTTTHHHHHHHHHHHHTccccccH DISOP:02AL 1-2,428-433| PSIPRED cccccEEEEEcccccEEEEEEEccccccEEEEEEcccccccccEEEEEccccccccccccccccHHHHHHHccccccccEEHHHHHcccccccccEEccccEEcHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHcccccccEEEEEEccccEEEEEEEEEcccEEEEEEEEEcccccEEcHHHHHHHHHHHHHHHHcccccccccccHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccc //