[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86802.1
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  166/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->173 3bruB PDBj 5e-22 36.1 %
:RPS:PDB   5->193 3bruB PDBj 1e-14 30.6 %
:RPS:SCOP  3->75 2fbqA1  a.4.1.9 * 2e-10 19.2 %
:RPS:SCOP  80->192 1sgmA2  a.121.1.1 * 6e-12 14.8 %
:HMM:SCOP  3->76 2g7sA1 a.4.1.9 * 2.3e-13 27.0 %
:HMM:SCOP  78->194 2g7sA2 a.121.1.1 * 9.5e-12 31.0 %
:HMM:PFM   12->57 PF00440 * TetR_N 9.3e-13 28.3 46/47  
:BLT:SWISS 4->173 DHAR_MYCSX 2e-14 28.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86802.1 GT:GENE AAK86802.1 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 988649..989275 GB:FROM 988649 GB:TO 989275 GB:DIRECTION + GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAK86802.1 GB:DB_XREF GI:15156008 LENGTH 208 SQ:AASEQ MNGQSATRTRLISEGMRQLLAHGYEGVGIGPILKEVDVPKGSFYYFFASKDDFVVAVIEAYEQKYAHIRERLFSDTSLRALQRLSVYFETLELELKQDGPYAGCLYGVIAQTSAGRSALVRDALAISFGRWETSIRELLTQAQYEDDIAGDEDVSDLCACIIEAYEGALIRVKATGDIAAFTRFRIKGLQRLMANMHHNGRVVSEDGR GT:EXON 1|1-208:0| BL:SWS:NREP 1 BL:SWS:REP 4->173|DHAR_MYCSX|2e-14|28.9|166/198| BL:PDB:NREP 1 BL:PDB:REP 5->173|3bruB|5e-22|36.1|166/186| RP:PDB:NREP 1 RP:PDB:REP 5->193|3bruB|1e-14|30.6|186/186| HM:PFM:NREP 1 HM:PFM:REP 12->57|PF00440|9.3e-13|28.3|46/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 3->75|2fbqA1|2e-10|19.2|73/79|a.4.1.9| RP:SCP:REP 80->192|1sgmA2|6e-12|14.8|108/111|a.121.1.1| HM:SCP:REP 3->76|2g7sA1|2.3e-13|27.0|74/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 78->194|2g7sA2|9.5e-12|31.0|116/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 196 OP:NHOMOORG 167 OP:PATTERN -------------------------------------------------------------------- --1----------------------1--------------------------------------1--1-------------------------------------1----------------------------------------1-------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------231--------------------1--1---1---1---11--1---2----------1-1--------------1----1------------------------------1--1-1---12221221----221------12----11--111-1----1-----1-1--------------1-11-22---1--1---1----211-11--------1----------------------------1-1-1111111111-2-1111-1-111-----2--------11---111111-11111-12-111---11---11---222----11-1111111111111-111111111--------------------------11--1---------------111111-112212222--1121---1112----------1--------11111----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 193 STR:RPRED 92.8 SQ:SECSTR ###cccHHHHHHHHHHHHHHHTccTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTcTTccHHHHHHHHHHHccHHHHTTTTccccHHHHHHHHTGGccTHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccTTccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHGGGcccHH############ DISOP:02AL 1-5, 8-9, 197-208| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccc //