[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86806.1
DDBJ      :             Conserved Hypothetical Protein
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  469/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->107 2fswB PDBj 4e-16 41.1 %
:RPS:PDB   14->110 3echB PDBj 2e-10 13.4 %
:RPS:SCOP  15->110 1z7uA1  a.4.5.69 * 2e-32 42.1 %
:HMM:SCOP  8->110 2fswA1 a.4.5.69 * 6.4e-32 49.0 %
:RPS:PFM   24->110 PF01638 * HxlR 3e-26 55.8 %
:HMM:PFM   24->110 PF01638 * HxlR 5.8e-36 47.7 86/91  
:BLT:SWISS 11->109 YDEP_BACSU 9e-30 56.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86806.1 GT:GENE AAK86806.1 GT:PRODUCT Conserved Hypothetical Protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 993685..994074 GB:FROM 993685 GB:TO 994074 GB:DIRECTION + GB:PRODUCT Conserved Hypothetical Protein GB:PROTEIN_ID AAK86806.1 GB:DB_XREF GI:15156012 LENGTH 129 SQ:AASEQ MSRPRAKLTGNFPGCPVESALSFLDGKWKGVILYHLINEGTLRFNELRRHIPSVTQRMLTKQLRELEEAGLISRTVFPVVPPRVDYALTPLGETMRPVISALKSWGDAHVVCKNGEKYTRAPTVAEKAA GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 11->109|YDEP_BACSU|9e-30|56.1|98/128| BL:PDB:NREP 1 BL:PDB:REP 15->107|2fswB|4e-16|41.1|90/100| RP:PDB:NREP 1 RP:PDB:REP 14->110|3echB|2e-10|13.4|97/135| RP:PFM:NREP 1 RP:PFM:REP 24->110|PF01638|3e-26|55.8|86/91|HxlR| HM:PFM:NREP 1 HM:PFM:REP 24->110|PF01638|5.8e-36|47.7|86/91|HxlR| RP:SCP:NREP 1 RP:SCP:REP 15->110|1z7uA1|2e-32|42.1|95/108|a.4.5.69| HM:SCP:REP 8->110|2fswA1|6.4e-32|49.0|102/0|a.4.5.69|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1261 OP:NHOMOORG 497 OP:PATTERN 11------------11----1---4223112---1----1---681-2-1221--------11----- 2---9--2222---1---------15-----1-2225343-94C33-1-11-311--3--211-7-6966--111-11--231-1-1-1211-12----1-B---c6C-2----------------------------------115-1322---111-----11-21221---------------11--121799999A5936B978A4688888181-15364322222CI1------1--11---2---33-5-22-12--653323433131243---1-----1------------1111-1111111-11---11111--8H2223222141-6111-1121----1---341------1---2-312-11331-----34444--13222-----------3-23142426291-9664861778234352--331--1-1211111111-323---2-----------------------------2-2112----2345272-222211312222223221252----31-1--31111--3--1112----------2-1-111-2111-31111-11---11111---21-13-11-2121-1-1--------2---221-12--1-1--------1-----------1-------------2136-3-1111111111-111111111111111111122264--11111--1---11111121111111--311111111111---------1111--422---211-----1--155555-2--1-122-22124------123-------------1-----1----32131321111111---2----------------1----1------------------------------112 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------3-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 79.8 SQ:SECSTR #############HHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHTTTHHHHHccHHHHHHHHHTTcEEEEEccccTTcEEEEEcHHHHHHHHHHHHHHHHHHHHHHTHHHH############# DISOP:02AL 1-10, 121-129| PSIPRED ccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcHHcccccc //