[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86810.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
e.52.1
:302 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   86->139 2qvlA PDBj 1e-04 43.1 %
:RPS:PDB   2->293 2bonA PDBj 3e-20 16.9 %
:RPS:SCOP  86->296 2qv7A1  e.52.1.2 * 2e-22 19.6 %
:HMM:PFM   3->125 PF00781 * DAGK_cat 1.3e-21 27.4 117/129  
:BLT:SWISS 86->295 Y507_STAES 4e-10 29.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86810.2 GT:GENE AAK86810.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 998242..999150 GB:FROM 998242 GB:TO 999150 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86810.2 GB:DB_XREF GI:159139872 LENGTH 302 SQ:AASEQ MKLIAIFNRDGGTFRTTDMDAYCDHARAVFSRAGHEIDCRLVSGKDIVKEMERAAEEPGIEGIIAGGGDGTISAAAAIAWKHGIALGIVPAGTMNLFARSLKLPLDIRQALETLAHGEIASVDIASVNGRLFVHQFSAGLHSRMVRYRNNLAFASRLGKIKASIRAAISVILNPPVFEVEYTVNGKTQHRKVSAISVSNNEFGQNSLLVAENVSGGHLGFYLTDPLRPSGVAKLALDILRGKLKENAAVTAMTVTDVELHFPKKRHDVRCVIDGELLPMERDVALKVHAGELKVLVGRAFFA GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 86->295|Y507_STAES|4e-10|29.5|193/307| SEG 52->85|eraaeepgiegiiagggdgtisaaaaiawkhgia| BL:PDB:NREP 1 BL:PDB:REP 86->139|2qvlA|1e-04|43.1|51/274| RP:PDB:NREP 1 RP:PDB:REP 2->293|2bonA|3e-20|16.9|266/287| HM:PFM:NREP 1 HM:PFM:REP 3->125|PF00781|1.3e-21|27.4|117/129|DAGK_cat| RP:SCP:NREP 1 RP:SCP:REP 86->296|2qv7A1|2e-22|19.6|189/299|e.52.1.2| OP:NHOMO 65 OP:NHOMOORG 62 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------111---------1-----------------------------------------11-11-----------------1--------------1--------------------------------1----------------------------------------------------------111---------------------------------------------11--------------------------------------------------------------11---1--------------1-11-11-1-13--1111111111111-------1111----------------11---------------------------------------------------------------------------1---1-----------1-------------1-----------------------------12----------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------11111-1---------------------------------------------------------------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 91.4 SQ:SECSTR #cEEEEEccccTTcHHHH######HHHHHHHTTTccEEEEEcccHHHHHHHHHHTccEEEEEEcHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHTTccccHHHHHHHHHHcEEEEEEEEEETTcEEccEEEEEEEEEcccHHHHHH#########HHHHHHTccEEEEEcEEEEEEETTEEEEEEEcEEEEEcccTTTccccTTccTTcccEEEEETccEccccccHHHHHHHHTTcccTTEEEEEEEcEEEEEEEEEEEEEEEEETTEEE#EEEEEEEEEEEEEEE######### DISOP:02AL 302-303| PSIPRED cEEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHcccccEEEEEcccHHHHHHHHcccccHHHHHHHHHHccEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEEEEEEccEEEEEEEEEEEEEccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEccccccEEEEEccccccccccEEEEEEcccEEEEccccccc //