[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86819.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   61->111 PF09917 * DUF2147 1e-04 49.0 %
:HMM:PFM   26->111 PF09917 * DUF2147 4.6e-18 40.7 86/114  
:BLT:SWISS 15->97 ACSF4_HUMAN 5e-04 31.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86819.2 GT:GENE AAK86819.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1004757..1005095) GB:FROM 1004757 GB:TO 1005095 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86819.2 GB:DB_XREF GI:159139880 LENGTH 112 SQ:AASEQ MKRIMTIAAALMMSGNLAFAGEAIEGNWKTASGETAVIGPCGGAFCVTLKTGKHAGKQIGKLSGKGNSYSGEITDPANDKTYSGSGTVSGNSLSMKGCVLKILCKSQTWTRL GT:EXON 1|1-112:0| BL:SWS:NREP 1 BL:SWS:REP 15->97|ACSF4_HUMAN|5e-04|31.3|83/1098| RP:PFM:NREP 1 RP:PFM:REP 61->111|PF09917|1e-04|49.0|51/113|DUF2147| HM:PFM:NREP 1 HM:PFM:REP 26->111|PF09917|4.6e-18|40.7|86/114|DUF2147| OP:NHOMO 44 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1-2111111111-111-11-11-11-1--122111122211------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,54-70| PSIPRED cHHHHHHHHHHHHHcccccccccccccEEcccccEEEEccccccEEEEEEEccccccccccccccccEEEEEEEEcccccEEEEEEEEcccEEEEEEEEEEEcccccEEEEc //