[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86820.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   12->69 3e4bC PDBj 1e-06 23.2 %
:HMM:PFM   22->53 PF08238 * Sel1 2.3e-07 37.5 32/39  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86820.1 GT:GENE AAK86820.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1005698..1005961 GB:FROM 1005698 GB:TO 1005961 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86820.1 GB:DB_XREF GI:15156028 LENGTH 87 SQ:AASEQ MARFDISDIEMAAGGETRADTLCNLGLVYATGRGCKVDLIAAHKWLNIAAIRGSERAASLRADLARNMTKAELAEALRAARDWMTMH GT:EXON 1|1-87:0| SEG 71->81|aelaealraar| RP:PDB:NREP 1 RP:PDB:REP 12->69|3e4bC|1e-06|23.2|56/405| HM:PFM:NREP 1 HM:PFM:REP 22->53|PF08238|2.3e-07|37.5|32/39|Sel1| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11111111111111111---------111-11-111111111---11--------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 66.7 SQ:SECSTR #########HTHHTTcTTTTH##HHHHHHHTcTTccccHHHHHHHHHHHGGGccHHHHHHHHHHHccHH################## DISOP:02AL 72-74| PSIPRED ccHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //