[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86825.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->97 PF05957 * DUF883 2e-07 32.1 84/94  
:BLT:SWISS 10->72 ATPFD_MYCSS 1e-04 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86825.1 GT:GENE AAK86825.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1010508..1010849) GB:FROM 1010508 GB:TO 1010849 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86825.1 GB:DB_XREF GI:15156035 LENGTH 113 SQ:AASEQ MAQTKLNVVEDTIENQIAELRSQISSLSKSVSARAEGVSEDASEFLDEARGRVRKAAHNVRAQGQNVVEAVKENPGTATSLLTIVGALGFAIGYVVGTSTQQSSSNSSLYRWR GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 10->72|ATPFD_MYCSS|1e-04|31.7|63/443| SEG 98->108|tstqqsssnss| HM:PFM:NREP 1 HM:PFM:REP 11->97|PF05957|2e-07|32.1|84/94|DUF883| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111111----------1---1-----------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 31-46, 99-109| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //