[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86828.1
DDBJ      :             outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.4.3
:369 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  56->369 3prnA_ f.4.3.1 * 1.9e-18 22.1 %
:RPS:PFM   32->353 PF02530 * Porin_2 3e-23 36.9 %
:HMM:PFM   1->356 PF02530 * Porin_2 5.2e-119 47.2 337/402  
:BLT:SWISS 30->369 Y4FJ_RHISN 1e-81 53.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86828.1 GT:GENE AAK86828.1 GT:PRODUCT outer membrane protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1012325..1013434 GB:FROM 1012325 GB:TO 1013434 GB:DIRECTION + GB:PRODUCT outer membrane protein GB:PROTEIN_ID AAK86828.1 GB:DB_XREF GI:15156038 LENGTH 369 SQ:AASEQ MNIKSLLIGSAAALAAVSGAHAADAIVAAEPEPLEYVRVCDAFGTGFFYIPGTETCLKFGGYVRFQTDFGRDKSGVSDWDSFTRAQFEVDTRTDTELGALRGFIGLRGNADNGSSSSSSVFVDQAFIELGGLKVGKFYSWWDDGLSGESDVLSTNALFNSIRYTYDAGSFWAGVSVDELEGTGSQFATITGPANGLGLFPLSQELDNNVGIALGLGAKLGAASLQLIGGYDIDQEEGAIRLIATADLGPGTLGLAGVWASGANAYYAESEWAVAAEYAIKATDKLTITPGGQYFGNVADRIALTNAAGVPTGASAIITNDWSNRDAWQAGVTIDYKITSGLSTKVAVNYYDEDNRDEQWKGFVRLQRSF GT:EXON 1|1-369:0| BL:SWS:NREP 1 BL:SWS:REP 30->369|Y4FJ_RHISN|1e-81|53.2|299/343| SEG 7->29|ligsaaalaavsgahaadaivaa| SEG 114->119|ssssss| SEG 210->224|gialglgaklgaasl| RP:PFM:NREP 1 RP:PFM:REP 32->353|PF02530|3e-23|36.9|295/357|Porin_2| HM:PFM:NREP 1 HM:PFM:REP 1->356|PF02530|5.2e-119|47.2|337/402|Porin_2| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF02530|IPR003684| GO:PFM GO:0015288|"GO:porin activity"|PF02530|IPR003684| GO:PFM GO:0016020|"GO:membrane"|PF02530|IPR003684| HM:SCP:REP 56->369|3prnA_|1.9e-18|22.1|272/0|f.4.3.1|1/1|Porins| OP:NHOMO 137 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111213243213233221222221225-3233323525-193324433342222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 369-370| PSIPRED ccEEEEEHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccEEEEcccccEEEEEEEEEEEEEEcccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEcccccccccEEEEEEEEEEEccEEEEEEEEccccccccccccccccEEEEEEEEEEEcccEEEEEEEEcccccccccccEEccccccEEEEEcccccccEEEEEEEcccccccEEEEEEEEEEcccccEEEEEEEEEccccEEEEEEEEEcccccccccccccEEEEEEEEccccEEEEEEEEcccccccccccccccccccccEEEEEccccccHHHHcccEEEEEEccccEEEEEEEEEccccccccEEEEEEEEEcc //