[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86850.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  204/915 : Eukaryota  119/199 : Viruses  0/175   --->[See Alignment]
b.165.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->125 2b2mA PDBj 7e-25 12.0 %
:RPS:SCOP  3->126 2exnA1  b.165.1.1 * 7e-23 11.9 %
:HMM:SCOP  3->130 2exnA1 b.165.1.1 * 2.2e-21 35.2 %
:RPS:PFM   1->111 PF03476 * MOSC_N 2e-13 38.2 %
:RPS:PFM   133->244 PF03473 * MOSC 3e-12 39.8 %
:HMM:PFM   135->264 PF03473 * MOSC 2.4e-29 40.0 110/133  
:HMM:PFM   2->112 PF03476 * MOSC_N 2.4e-19 31.5 111/120  
:BLT:SWISS 6->272 YCBX_ECOLI 9e-37 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86850.2 GT:GENE AAK86850.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1033792..1034634) GB:FROM 1033792 GB:TO 1034634 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86850.2 GB:DB_XREF GI:159139893 LENGTH 280 SQ:AASEQ MLVTELNIYPLKSARGIALKESAVSAEGLPGDRRAMLTDPSGHFITQRELPAIATVLARHEDGGMALSRERSGEIFARPSGQRMDVAVWKSIVSANIADDETNDTLSAWLGREVKLVFFDDAAKRIASLEWTGNETPVTFADGYQILVTTTASLAALNDNMRGNGEDAVGMERFRPNIVLETEEAWAEDRWAAIEIGGIRFDLVKPCARCIMTTQDQMTGSRDVPSPMKAMGRIRMSGDRRVPGPLFGWNVTPRGEGRLSVGDVARVVEERPEGWAIKRR GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 6->272|YCBX_ECOLI|9e-37|37.0|257/369| RP:PDB:NREP 1 RP:PDB:REP 3->125|2b2mA|7e-25|12.0|117/130| RP:PFM:NREP 2 RP:PFM:REP 1->111|PF03476|2e-13|38.2|110/117|MOSC_N| RP:PFM:REP 133->244|PF03473|3e-12|39.8|108/139|MOSC| HM:PFM:NREP 2 HM:PFM:REP 135->264|PF03473|2.4e-29|40.0|110/133|MOSC| HM:PFM:REP 2->112|PF03476|2.4e-19|31.5|111/120|MOSC_N| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF03473|IPR005302| GO:PFM GO:0030151|"GO:molybdenum ion binding"|PF03473|IPR005302| GO:PFM GO:0030170|"GO:pyridoxal phosphate binding"|PF03473|IPR005302| RP:SCP:NREP 1 RP:SCP:REP 3->126|2exnA1|7e-23|11.9|118/128|b.165.1.1| HM:SCP:REP 3->130|2exnA1|2.2e-21|35.2|122/0|b.165.1.1|1/1|MOSC N-terminal domain-like| OP:NHOMO 466 OP:NHOMOORG 323 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11---12122-------------------------------1---1-2------------------------------------1-------1----------1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1------------------------1-1-----111111111111---------------11111111-11----------------------------------------11-11-111111111-111-1111-1111---------11111111-1111-----1--------------1----------------------------1-----------------------------11--11----11-------------------------------1111-111111111111-1111111111111111111111111111111111111111111111111111-111111111111---------------111111--------1---------------11111111111111111----------11111111111111-----------------------------------------------------------------------1- ----211-------1231111111112-------------------22-12132-----------------------------------1223111------1111-15-7252514332112243-435G3-4352211613412111-1-142115111123421123153321--161111222312321111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 41.8 SQ:SECSTR ##cccccccccTTTcccccGG######GGGccccEEEEcTTccEEcTTTcGGGGGcEEEEETTEEEEEcccccEEcTTccccEEEEEETTEEEEEEEccHHHHHHHHHHTccccEEEEEcTTTcc########################################################################################################################################################### DISOP:02AL 122-136| PSIPRED cEEEEEEEEcccccccEEEEEEEEccccccccEEEEEEcccccEEEHHcccEEEEEEEEEEccEEEEEEcccccEEEcccccccccEEEccEEEEEEcccHHHHHHHHHHcccEEEEEEccccccccccccccccccEEEcccccccEEcHHHHHHHHHHccccccccccHHHcccEEEEEcccccccccccEEEEccEEEEEEccccccEEEcccHHHccccHHHHHHHHHHHcccccccccccEEEEEEEEcccEEEEEccEEEEEEEcccEEEEEEc //