[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86851.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  20/68 : Bacteria  213/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
a.211.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->197 3gw7A PDBj 6e-30 41.5 %
:RPS:PDB   21->214 3djbA PDBj 3e-11 31.9 %
:RPS:SCOP  23->214 2pjqA1  a.211.1.1 * 3e-52 33.7 %
:HMM:SCOP  26->168 1xx7A_ a.211.1.1 * 1.8e-07 23.8 %
:HMM:PFM   32->133 PF01966 * HD 3.6e-12 29.3 99/118  
:BLT:SWISS 26->197 YEDJ_ECOLI 5e-37 43.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86851.1 GT:GENE AAK86851.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1034646..1035290) GB:FROM 1034646 GB:TO 1035290 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86851.1 GB:DB_XREF GI:15156065 LENGTH 214 SQ:AASEQ MIAAEAFAPHAALAQDLIPHAADTGDGSHDLAHIHRVFRNAMRIHAGEGGDGNVLAASVLLHDCVAVEKNSPLRAQASRLAAEKASGILAGLGWQKQDIDAAAHAITTHSFSANIEPQTLEAKILQDADRLDAIGMVGAARCFYIAGRMGSALYDPADPLAKERPLDDRAFAIDHFETKLFKLADGFRTETGRQMAKARHERLKQVLDLFLDEI GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 26->197|YEDJ_ECOLI|5e-37|43.0|172/231| SEG 3->14|aaeafaphaala| BL:PDB:NREP 1 BL:PDB:REP 31->197|3gw7A|6e-30|41.5|159/215| RP:PDB:NREP 1 RP:PDB:REP 21->214|3djbA|3e-11|31.9|163/180| HM:PFM:NREP 1 HM:PFM:REP 32->133|PF01966|3.6e-12|29.3|99/118|HD| RP:SCP:NREP 1 RP:SCP:REP 23->214|2pjqA1|3e-52|33.7|178/206|a.211.1.1| HM:SCP:REP 26->168|1xx7A_|1.8e-07|23.8|126/0|a.211.1.1|1/1|HD-domain/PDEase-like| OP:NHOMO 296 OP:NHOMOORG 290 OP:PATTERN --1-1-----------1------1--------------------1-11-111111111111------1 ------------------------------------------------------------------------------1--------------------1-11111--11----------------------------------1--------------------------------------1---------1111111111111111111111111---111111--1-111111111111111111111111-111111111111111-11111-11111---------------------------------------1-1--1111----1--------------------11-----------------2--------------------------------1---1---------111111111111--------------1---------------1--------------------------------1--11111-------------1-------1-----------------------1-----1-------------211-1------------1------------1-------------------------------1-----11---------------------------------1111-111111111111-1111111111111-11--1111---1-1-111111111111111111--111------------------------------1--------------------------------11--1-1--111----------1111--1--111----------------------------------1----------------------------1----------- ----11-----------1--111--1--1----11111111111-11111111---1---111--------------------------1----1--11----1---1-1------------------------------------------------------------------111511111-111111--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 200 STR:RPRED 93.5 SQ:SECSTR ##############HHHccTHTTccccTTTHHHHHHHHHHHHHHHHTTTcccHHHHHHHTTHHHHccccccTTHHHHHHccTHHHHHHHHHTcccHHHHHHHHHHTHHHHHHHcccTccHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHTccccTTccccccHHHTccccTTHHHHHHTGGGTTTcccHHHHHHHHHHHHHHHHHHHHHHHHT DISOP:02AL 1-4| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcc //