[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86864.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   48->143 PF09539 * DUF2385 4e-19 52.6 %
:HMM:PFM   47->143 PF09539 * DUF2385 1.1e-39 56.2 96/96  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86864.2 GT:GENE AAK86864.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1048008..1048445) GB:FROM 1048008 GB:TO 1048445 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86864.2 GB:DB_XREF GI:159139897 LENGTH 145 SQ:AASEQ MIRPTIFLSLFLTMLAISGQEGVAYAQPSKSVSEARPAEAAPPKPAPYDDKLARLSEILGAVQYLRTLCPSSGPEDWRKSMSALLAADTASEPERRQRMTAAFNRGYRSFAAIHTSCTRAAIMAEENYRNEGATLAQEIASRFGN GT:EXON 1|1-145:0| TM:NTM 1 TM:REGION 1->23| SEG 35->47|arpaeaappkpap| RP:PFM:NREP 1 RP:PFM:REP 48->143|PF09539|4e-19|52.6|95/96|DUF2385| HM:PFM:NREP 1 HM:PFM:REP 47->143|PF09539|1.1e-39|56.2|96/96|DUF2385| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111-11111111111-111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,36-44,144-146| PSIPRED cccHHHHHHHHHHHHHHccccHHHHHHcccHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //