[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86867.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  309/915 : Eukaryota  119/199 : Viruses  1/175   --->[See Alignment]
d.303.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->232 2icuB PDBj 1e-21 40.0 %
:RPS:PDB   2->227 2bdvA PDBj 9e-63 27.6 %
:RPS:SCOP  2->227 2bdvA1  d.303.1.1 * 7e-62 28.9 %
:HMM:SCOP  2->227 2bdvA1 d.303.1.1 * 3.1e-78 47.2 %
:RPS:PFM   1->205 PF02586 * DUF159 3e-40 47.4 %
:HMM:PFM   1->224 PF02586 * DUF159 7.2e-58 40.7 204/208  
:BLT:SWISS 1->230 YOQW_BPSPC 4e-36 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86867.1 GT:GENE AAK86867.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1049426..1050187 GB:FROM 1049426 GB:TO 1050187 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86867.1 GB:DB_XREF GI:15156085 LENGTH 253 SQ:AASEQ MCGRFVLKATPEEIADYLDLIGLEDFPARFNIAPTQPILVVMEGEQQERGSNLPNRRAVLVRWGFMPGWVKDPKDFPLLINARSETAIGKASFRAAMRHRRVLIPATGFYEWRRPPKEEGGKAQPYFIRPKNGGIVAFAGLMETWSSADGSEVDTGAILTTAANAAIGRIHDRMPVVIAPEDFSRWLDCKTQEPREVADLMRPVQGDFFEMIPVSDKVNKVANVGADLIDPVPESAPLAKVRPAKDDGQMSLF GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 1->230|YOQW_BPSPC|4e-36|39.0|218/224| BL:PDB:NREP 1 BL:PDB:REP 3->232|2icuB|1e-21|40.0|200/210| RP:PDB:NREP 1 RP:PDB:REP 2->227|2bdvA|9e-63|27.6|210/210| RP:PFM:NREP 1 RP:PFM:REP 1->205|PF02586|3e-40|47.4|194/204|DUF159| HM:PFM:NREP 1 HM:PFM:REP 1->224|PF02586|7.2e-58|40.7|204/208|DUF159| RP:SCP:NREP 1 RP:SCP:REP 2->227|2bdvA1|7e-62|28.9|211/213|d.303.1.1| HM:SCP:REP 2->227|2bdvA1|3.1e-78|47.2|212/0|d.303.1.1|1/1|BB1717-like| OP:NHOMO 519 OP:NHOMOORG 439 OP:PATTERN ------------------------23311111------------1--1-------------------- 21--11111111--11112-1111111111111111122111111122132-122111--111-1121111----1------1-------1----------1--1-1-----------------1---11---111111-----1-1--1---11--111111---1111-111111111111-----11-------------------1-11-3---111-1--------12------------------------------------------1-----------------------------------------------1-1------------1-------1---1--1--11---1111----1---1-----------11111111111111111111-112-1111111-221-1111342222111111-1-1111111211111111111--111------------------------------11----2-1-------1------1---------2-----1--------11-1-1--1---1----------211-2-1-------1-------1--1-12----111--------------------------1-----311----2----1------1---------111--------1-----1111111111-111111111-111-11---221-----1---1111--1-1--1-111---11----------------------211---11--------------------------2-11212524122332124----------------------------------------1-11--------------1-----------------------------------1-- ------1-----11111111111111111-1-111111111111111111-11-111-1111---111--11-1-11-111--------1211111---1---1----21-11-1-111-112----2-252-111--1-1-11-----12113-211111--111-111---1-111------11111111---1-1- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 231 STR:RPRED 91.3 SQ:SECSTR #cccEEEcccHHHHHHHHccccccccccEEEEcTTcccEEEcTTTTccEEEEccEcEEEEcccccccTTHHHHHHcccccEEEHHHHHTTcTTGGGTTTcEEEEEEEEEEEEEEccccccccccEEEEEEEEEEEEEEEEEEcccTTccccGGGcEEEEEcGGGcccccTTccccccccHHHHHHHHcTTccHHHHHHHHTccccGGGcEEEEccccccccTTccccGGccc##################### DISOP:02AL 234-247| PSIPRED ccccccccccHHHHHHHHccccccccccccccccccEEEEEEEccccccccccccEEEEEEEccccccccccccccccEEEEEcccccccHHHHHHHHcccEEEEEEcEEEcccccccccccccEEEEEEccccEEEEEEEEcccccccccEEEEEEEEEEcccHHHHHHHccccEEEcHHHHHHHcccccccHHHHHHHHcccccccEEEEEccccccccccccHHHHccccccccHHHcccccccccEEcc //