[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86877.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  409/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:302 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  54->157 1s7bA_ f.39.1.1 * 7.9e-08 22.8 %
:HMM:SCOP  193->301 1s7bA_ f.39.1.1 * 1.4e-07 16.2 %
:HMM:PFM   28->153 PF00892 * EamA 5.6e-13 25.4 122/126  
:HMM:PFM   168->291 PF00892 * EamA 4.5e-07 14.9 121/126  
:BLT:SWISS 17->302 Y485_PSEAE 2e-57 36.4 %
:TM
:REPEAT 2|29->153|170->293

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86877.2 GT:GENE AAK86877.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1060840..1061748) GB:FROM 1060840 GB:TO 1061748 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86877.2 GB:DB_XREF GI:159139905 LENGTH 302 SQ:AASEQ MALDKTLPAQEGGDSARGFAFALSAYLLWGFLPFYMKAVAHISPIEVIVHRVIWSVPIAAVVLIALGRTAEIRTALRNPKMLAMASLTAALISINWGVYIWSIGAGRALDAALGYFINPLFSIFLGAVLLKEKLYPAQIAAICLVGLAVAILTWHAGSLPWVSIALTVSWGFYAFFRKTLPIGATQGFLLEVMLLSIPAVLVMIWLAFSGQAHFMGGNSADTWLLAASGVITAVPLILYGNGAKLLRLSTIGIMQYIAPTMIFLIAIFIFKEPFDMVRMAAFAMIWVALAIYTGSSLMRLKR GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 17->302|Y485_PSEAE|2e-57|36.4|286/298| TM:NTM 9 TM:REGION 17->39| TM:REGION 47->69| TM:REGION 81->103| TM:REGION 110->131| TM:REGION 145->167| TM:REGION 187->209| TM:REGION 220->242| TM:REGION 247->269| TM:REGION 276->298| NREPEAT 1 REPEAT 2|29->153|170->293| HM:PFM:NREP 2 HM:PFM:REP 28->153|PF00892|5.6e-13|25.4|122/126|EamA| HM:PFM:REP 168->291|PF00892|4.5e-07|14.9|121/126|EamA| HM:SCP:REP 54->157|1s7bA_|7.9e-08|22.8|101/106|f.39.1.1|1/2|Multidrug resistance efflux transporter EmrE| HM:SCP:REP 193->301|1s7bA_|1.4e-07|16.2|105/106|f.39.1.1|2/2|Multidrug resistance efflux transporter EmrE| OP:NHOMO 486 OP:NHOMOORG 411 OP:PATTERN ----------------------------------------------------------11-------- ----11111111111------1---1------11111111----11-1-11-111111--111-1--1111----------1-----------1-------11----1----------------------------11111---1----------------------------------------------11111111111111111111111111111111211111111111111111111111111111--------------------11----111----------------------------------111---------------------11--------------11-1---1-----------11111------------------111111111-1-111111111111111111111111--211-111111112-------------1-1-----------------------------11111------1111112----1113------1111111--1111-111---1--221----11------------1--1-2-11--1111-1-1--1---1111-1---2311----------------------22111-211121122111311112121122-------------111111-1111111111-1111111111111111111111111122222222222222222211111111-111111111111---1-----------111222121-22212--1-------1321-22222222221211212----------222211111221221121111111-------1-----------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //