[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86881.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  128/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:122 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->119 3hrlA PDBj 2e-18 52.9 %
:RPS:PDB   7->119 1cw0A PDBj 1e-08 21.8 %
:RPS:SCOP  7->119 1cw0A  c.52.1.15 * 1e-16 21.8 %
:HMM:SCOP  2->119 1cw0A_ c.52.1.15 * 9.1e-27 27.0 %
:RPS:PFM   32->114 PF04480 * DUF559 3e-20 53.0 %
:HMM:PFM   10->116 PF04480 * DUF559 6.2e-43 52.4 105/109  
:BLT:SWISS 12->122 Y1162_HAEIN 2e-21 42.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86881.2 GT:GENE AAK86881.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1063863..1064231) GB:FROM 1063863 GB:TO 1064231 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86881.2 GB:DB_XREF GI:159139906 LENGTH 122 SQ:AASEQ MPHAKVKPQHREHARQMRKALTDAELKFWNAVRAHRLDGLSFRRQLPVAGYIVDFACPSHKIIVELDGFQHAEDAAAAYDRQRTRTLEELGWTVLRFWNDDILKDIDNVCLHIIRTAEENQP GT:EXON 1|1-122:0| BL:SWS:NREP 1 BL:SWS:REP 12->122|Y1162_HAEIN|2e-21|42.2|109/157| BL:PDB:NREP 1 BL:PDB:REP 22->119|3hrlA|2e-18|52.9|87/91| RP:PDB:NREP 1 RP:PDB:REP 7->119|1cw0A|1e-08|21.8|110/155| RP:PFM:NREP 1 RP:PFM:REP 32->114|PF04480|3e-20|53.0|83/92|DUF559| HM:PFM:NREP 1 HM:PFM:REP 10->116|PF04480|6.2e-43|52.4|105/109|DUF559| RP:SCP:NREP 1 RP:SCP:REP 7->119|1cw0A|1e-16|21.8|110/155|c.52.1.15| HM:SCP:REP 2->119|1cw0A_|9.1e-27|27.0|115/155|c.52.1.15|1/1|Restriction endonuclease-like| OP:NHOMO 186 OP:NHOMOORG 128 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-------------------1--1----------------------2-11---------1----1-311-112----------2---112---------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------13231-------112-2231364----------------12-12-1-21112213-1221---4--------------------------------------------------------3-23----------------------------------------------1-1----------1111111----1--1--1----------1122-1311--------------------------------------------------------------------1--1-------------1---1---11--111---1-1--111111--1----------------------111-1111-----------------------24-22----111--2-12113-------------1-------1------1----11-1-111-1---------------21111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 92.6 SQ:SECSTR ######HHHHHHHHHTccccccHHHHHHHHHHHHGTTTTcccEEccTTcTTcccEEEGGGTEEEEEEcTTTTTcccHHHHHHHHHHHHHTTcEEEEEEHHHHccTTcccHHHHHHHHHH### DISOP:02AL 1-2,12-21,121-123| PSIPRED cccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEEcccEEcccEEEEEEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHcHHHHHHHHHHHHHcccc //