[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86891.1
DDBJ      :             branched-chain amino acid permease
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  340/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:234 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->144 PF03591 * AzlC 2e-18 45.2 %
:HMM:PFM   19->158 PF03591 * AzlC 3.8e-43 47.1 140/143  
:BLT:SWISS 1->185 Y1755_ARCFU 3e-15 34.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86891.1 GT:GENE AAK86891.1 GT:PRODUCT branched-chain amino acid permease GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1073571..1074275 GB:FROM 1073571 GB:TO 1074275 GB:DIRECTION + GB:PRODUCT branched-chain amino acid permease GB:PROTEIN_ID AAK86891.1 GB:DB_XREF GI:15156113 LENGTH 234 SQ:AASEQ MSTSEKRAELIAGLRSAAPLLVAMVPIGVVFGAVAIGKGLSPLEASLMSLLVFAGGSQFVAMDLWTHPASWTALGFAALLVNLRHVLMSASIAGKLDDFKGWRKYAAMLVLTDESWALAEFRVIAGRLTAAFFAGAALSIYLVWNLATLAGALLGAVVGDMSVIGLDFAFPAVFIVLLMGFWKGRETGLVLLASASAACLTHALVPGAWYIAAGAMAGLAVAAFGRAEQVEQPA GT:EXON 1|1-234:0| BL:SWS:NREP 1 BL:SWS:REP 1->185|Y1755_ARCFU|3e-15|34.1|176/219| TM:NTM 5 TM:REGION 13->35| TM:REGION 40->62| TM:REGION 118->140| TM:REGION 153->175| TM:REGION 197->219| SEG 146->159|latlagallgavvg| SEG 189->204|lvllasasaaclthal| SEG 207->227|gawyiaagamaglavaafgra| RP:PFM:NREP 1 RP:PFM:REP 19->144|PF03591|2e-18|45.2|126/142|AzlC| HM:PFM:NREP 1 HM:PFM:REP 19->158|PF03591|3.8e-43|47.1|140/143|AzlC| OP:NHOMO 395 OP:NHOMOORG 352 OP:PATTERN -----------------------11---1-11------1111---------11--------------- ----11-------------------------------121--------1-------------1-------------11------------------------------------------------------------------2---------------------------------------11-----1211111112111111111-111-111111111111111111-11111111111111111111-1--1-----11--11-1--1-111111----111------------------------111111111--11-1---------1-111----1-111111-111-1111-1111-------------------------1111111111111112---1--1--121-12212221122211---1211111111---------------------------------------------1------11-2322223-----22111111122221111--112-----1-1-----2----22--111-1----1--11-1112111111-1-1--1----------1--1------------------1-----11111-1--11-1111-1-111111--111-------------1-12-1-1111111111-111111111111111111-2122211------------------1111111--111111111111---------------112111------------11-1111-----1111-11-1-2--1-------------1---111111211111----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 229-234| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccc //