Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86904.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:BLT:SWISS 16->74 RFWD3_MOUSE 8e-04 34.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86904.1 GT:GENE AAK86904.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1087925..1088233 GB:FROM 1087925 GB:TO 1088233 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86904.1 GB:DB_XREF GI:15156128 LENGTH 102 SQ:AASEQ MSRAASRSWFLRRSLRALTKHVLSFEEQIAACESHSAFRADIVVVYGRRLPVRDTSGRERLSPAALSETMVVKRNIRASRYLHVVRDGIPNLFLPHYLRKKR GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 16->74|RFWD3_MOUSE|8e-04|34.5|58/774| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 101-102| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccc //