[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86905.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  746/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:406 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   154->382 2r1fA PDBj 1e-36 45.5 %
:RPS:PDB   349->403 3d0qA PDBj 2e-04 23.6 %
:RPS:PFM   95->372 PF02618 * YceG 1e-73 56.9 %
:HMM:PFM   93->373 PF02618 * YceG 1.8e-101 53.1 275/295  
:BLT:SWISS 75->373 Y457_HAEIN 3e-51 39.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86905.1 GT:GENE AAK86905.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1088260..1089480 GB:FROM 1088260 GB:TO 1089480 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86905.1 GB:DB_XREF GI:15156129 LENGTH 406 SQ:AASEQ MSDTNQNSQGPSGQNGAGEGNRGPIIPKSPTEALRPEKVPAPPKRSRKAHGQLVIFLNFLMTLAVAVCVLAIAAFYYMINAFQEPGPLETNTHFTVRNGAGLIEIANNLERNDIISNARVFRLMTGSYLQKDQTLKTGEYEIKAGASMKDIMLLLESGKSILYSVSLPEGLTVKQMFARLAADEVLDGELPATLPPEGSLRPDTYRFTRGTKREEIISQMSAAQDKLIDMVWERRDPDLPIKTIEEFVTLASIVEKETGKDDERAHVASVFYNRLKKGMRLQSDPTIIYGLFGGDGKPSDRPIYQSDLQKQTPFNTYVIKGLPPSPIANPGRAALEAVANPWRTDDLYFVADGTGGHVFAKTLEEHNANVRRWRKIEAEKAASGGNPDVVVDGQPGGAEAEKPANN GT:EXON 1|1-406:0| BL:SWS:NREP 1 BL:SWS:REP 75->373|Y457_HAEIN|3e-51|39.7|292/347| TM:NTM 1 TM:REGION 54->76| SEG 63->74|lavavcvlaiaa| BL:PDB:NREP 1 BL:PDB:REP 154->382|2r1fA|1e-36|45.5|220/252| RP:PDB:NREP 1 RP:PDB:REP 349->403|3d0qA|2e-04|23.6|55/369| RP:PFM:NREP 1 RP:PFM:REP 95->372|PF02618|1e-73|56.9|267/291|YceG| HM:PFM:NREP 1 HM:PFM:REP 93->373|PF02618|1.8e-101|53.1|275/295|YceG| OP:NHOMO 753 OP:NHOMOORG 748 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111-222111111111111111111111111111--11111112111---------------1111111111111111---111--1---11--------1--1---1------------111111111111111111111111111111111111111111111111111-------------------1-1-11--1-111--11111---1111111111111111111111-11111111111111111111111111111111111111111111111-11--1--1111111111111111-1111-111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111------------1111111111111-----1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112-1111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111---------11111111111111111111111111111--111111111111111111--------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 76.6 SQ:SECSTR ####################################################################################EEEEEEccccTTcccccHHHHHHHHHHHTcEEEc#TTTTTcHHHHHH##HHHHHTccccEEEEEHHHHHHHHHcccccEEEEccTTcHHHHHHccTTcccccccccHHHHHHTTcccccEEHEcTTccHHHHHHHHHHHHHHHHHHHHHTccTTcccccHHHHHHcHHHHHHHcccGGGHHHHHHHHHHHHHHTcccccHHHHHHHGGGcccccc#####HHHHHcccTTcTTTcccccccccccccHHHHHHHHccccccccEEEccccTTccHHHHHHHTTcEEEEEEcccHHHHHTTTccEEEccTTccHHHHHHH### DISOP:02AL 1-52, 375-406| PSIPRED ccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHHcccHHHHccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHcccccccccEEcccccccccccHHHHHHHHHHccccccEEEEEEEccccEEEcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc //