[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86922.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.9
:160 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->158 3fpvA PDBj 1e-09 48.6 %
:RPS:PDB   17->159 2a2lA PDBj 2e-10 19.7 %
:RPS:SCOP  24->159 2a2lA1  d.110.9.1 * 6e-12 20.0 %
:HMM:SCOP  19->160 2a2lA1 d.110.9.1 * 3.3e-28 33.3 %
:HMM:PFM   27->157 PF03928 * DUF336 5.7e-37 39.2 130/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86922.1 GT:GENE AAK86922.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1108801..1109283 GB:FROM 1108801 GB:TO 1109283 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86922.1 GB:DB_XREF GI:15156150 LENGTH 160 SQ:AASEQ MIRTLLIVSALIAPSAALAQTLPTAPYLPLDMAEKATKAALQACSAKGNAVTVAIVTRDGATKTVLKADGSGPHTVPSATGKAFAAASLGRDIGEIAEFIASKPANDGLRNMDERLVIQAGGLPIKIGDALVGGIGVGGAPSGAIDAECAREGLNAIGAK GT:EXON 1|1-160:0| SEG 127->145|igdalvggigvggapsgai| BL:PDB:NREP 1 BL:PDB:REP 48->158|3fpvA|1e-09|48.6|107/141| RP:PDB:NREP 1 RP:PDB:REP 17->159|2a2lA|2e-10|19.7|142/145| HM:PFM:NREP 1 HM:PFM:REP 27->157|PF03928|5.7e-37|39.2|130/132|DUF336| RP:SCP:NREP 1 RP:SCP:REP 24->159|2a2lA1|6e-12|20.0|135/142|d.110.9.1| HM:SCP:REP 19->160|2a2lA1|3.3e-28|33.3|141/0|d.110.9.1|1/1|GlcG-like| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-----------1--1-----------11---------11-----1----------------------------------------------------------1-----------------1------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 91.2 SQ:SECSTR #############ccccccccccccccccHHHHHHHHHHHHHHHHHTTcccEEEEEETTccEEEEEEcTTccTTHHHHHHHHHHHHHHTTccGGGcGGGccTcTTTTGGGcGGGTccccccEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHH# DISOP:02AL 160-161| PSIPRED cHHHHHHHHHHHHHccccHHcccccccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccEEEcccEEEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHHccc //