[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86927.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:170 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   103->123 PF12021 * DUF3509 0.00095 52.4 21/94  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86927.2 GT:GENE AAK86927.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1113937..1114449) GB:FROM 1113937 GB:TO 1114449 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86927.2 GB:DB_XREF GI:159139922 LENGTH 170 SQ:AASEQ MRIALPLLLAIAAMLSLSGCQRDEPREVAKLSGRMFVFNYRVAVATYLVTLQRTAPIRDGSSVEAAFENPRGGPDLVARERIFPKDEKITVQSPPVECVKQDRPYRVSVQIKGPDGDTLQTIETTIRSDTDQSALPAKPLVVGPLYTPNPEVFKPDGSTDMRPVQGCPAS GT:EXON 1|1-170:0| TM:NTM 1 TM:REGION 1->19| SEG 3->18|ialplllaiaamlsls| HM:PFM:NREP 1 HM:PFM:REP 103->123|PF12021|0.00095|52.4|21/94|DUF3509| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111-11111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,21-22,163-164,166-171| PSIPRED cccHHHHHHHHHHHHccccccccccccEEEEcccEEEEEEEEEEEEEEEEEEEccccccccEEEEEEccccccccEEEEEEccccccEEEEEcccEEEEEccccEEEEEEEEcccccEEEEEEHEEEEcccccccccccEEEcccccccHHHHccccccccccccccccc //