[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86957.1
DDBJ      :             aspartyl-tRNA synthetase
Swiss-Prot:SYD_AGRT5    RecName: Full=Aspartyl-tRNA synthetase;         EC=6.1.1.12;AltName: Full=Aspartate--tRNA ligase;         Short=AspRS;

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.40.4c.72.1d.104.1
:595 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->590 1eqrA PDBj e-121 42.7 %
:RPS:PDB   5->589 1c0aA PDBj 1e-80 40.6 %
:RPS:SCOP  2->376 1gc5A  c.72.1.3 * 2e-46 8.7 %
:RPS:SCOP  413->590 1c0aA3  d.104.1.1 * 6e-24 33.7 %
:HMM:SCOP  4->108 1c0aA1 b.40.4.1 * 1.3e-35 45.7 %
:HMM:SCOP  111->591 1c0aA3 d.104.1.1 * 8.3e-98 34.0 %
:RPS:PFM   27->103 PF01336 * tRNA_anti 1e-04 39.4 %
:RPS:PFM   122->316,421->561 PF00152 * tRNA-synt_2 1e-51 54.0 %
:RPS:PFM   314->401 PF02938 * GAD 7e-09 36.5 %
:HMM:PFM   122->565 PF00152 * tRNA-synt_2 9.7e-110 53.7 315/323  
:HMM:PFM   21->104 PF01336 * tRNA_anti 7.4e-19 41.9 74/76  
:BLT:SWISS 1->595 SYD_AGRT5 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86957.1 GT:GENE AAK86957.1 GT:PRODUCT aspartyl-tRNA synthetase GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1144725..1146512 GB:FROM 1144725 GB:TO 1146512 GB:DIRECTION + GB:PRODUCT aspartyl-tRNA synthetase GB:PROTEIN_ID AAK86957.1 GB:DB_XREF GI:15156191 LENGTH 595 SQ:AASEQ MHRYRSHTCAALRKSDVGETVRLSGWVHRVRDHGGVLFIDLRDHYGITQVVADPDSPAFKVAETVRGEWVIRIDGLVKARSEDTINKGMATGEIELYAQEIEVLGVAKELPLPVFGEPEYPEDVRLKYRFLDLRRETLHRNIVKRTQIISSMRKGMGDLGFAEYTTPILTASSPEGARDFLVPSRIHEGQFFALPQAPQQYKQLLMVAGFDRYFQIAPCFRDEDPRADRLPGEFYQLDVEMSFVTQEDVWTTMEPMMTAVFEQFAEGKPVTKQWPRIPYDESIRKYGSDKPDLRNPIVMEAVTEHFDGSGFKVFANMIASNPKVQVWAIPAKTGGSRAFCDRMNAWAQSQGQPGLGYIFWKEEEGKVAGSGPLAKNIGEERTEALRQQLGLEAGDACFFVAGDPAKFYKFAGEARTRAADELNLIDRDRFEMCWIVDFPFFEYNEEEKKIDFAHNPFSMPQGGMEALEGQDPLSIKAFQYDAVCNGFEIASGSIRNQSPELMVKAFEKVGLSQSDVEERFGGLYRAFQYGAPPHGGCAFGIDRVVMLLVGAKNLREITLFPMNQQAQDLLMNAPSPATPTQLRELALRVVPSKKD GT:EXON 1|1-595:0| SW:ID SYD_AGRT5 SW:DE RecName: Full=Aspartyl-tRNA synthetase; EC=6.1.1.12;AltName: Full=Aspartate--tRNA ligase; Short=AspRS; SW:GN Name=aspS; OrderedLocusNames=Atu1153; ORFNames=AGR_C_2136; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->595|SYD_AGRT5|0.0|100.0|595/595| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 5->590|1eqrA|e-121|42.7|578/590| RP:PDB:NREP 1 RP:PDB:REP 5->589|1c0aA|1e-80|40.6|579/585| RP:PFM:NREP 3 RP:PFM:REP 27->103|PF01336|1e-04|39.4|66/74|tRNA_anti| RP:PFM:REP 122->316,421->561|PF00152|1e-51|54.0|310/337|tRNA-synt_2| RP:PFM:REP 314->401|PF02938|7e-09|36.5|85/96|GAD| HM:PFM:NREP 2 HM:PFM:REP 122->565|PF00152|9.7e-110|53.7|315/323|tRNA-synt_2| HM:PFM:REP 21->104|PF01336|7.4e-19|41.9|74/76|tRNA_anti| GO:PFM:NREP 11 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01336|IPR004365| GO:PFM GO:0000166|"GO:nucleotide binding"|PF00152|IPR004364| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00152|IPR004364| GO:PFM GO:0005524|"GO:ATP binding"|PF00152|IPR004364| GO:PFM GO:0005737|"GO:cytoplasm"|PF00152|IPR004364| GO:PFM GO:0006412|"GO:translation"|PF00152|IPR004364| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00152|IPR004364| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF02938|IPR004115| GO:PFM GO:0005524|"GO:ATP binding"|PF02938|IPR004115| GO:PFM GO:0005737|"GO:cytoplasm"|PF02938|IPR004115| GO:PFM GO:0006412|"GO:translation"|PF02938|IPR004115| RP:SCP:NREP 2 RP:SCP:REP 2->376|1gc5A|2e-46|8.7|346/467|c.72.1.3| RP:SCP:REP 413->590|1c0aA3|6e-24|33.7|178/346|d.104.1.1| HM:SCP:REP 4->108|1c0aA1|1.3e-35|45.7|105/0|b.40.4.1|1/1|Nucleic acid-binding proteins| HM:SCP:REP 111->591|1c0aA3|8.3e-98|34.0|347/0|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 2352 OP:NHOMOORG 1173 OP:PATTERN 11212111111111112233333111111111111111111112212211222122222222212122 2321222211121232222-22332222222222222233111221111222111111112112222111111111111121121222111112112--1111112112111111111111111122212211222322222233232321111111111112112232311211111211112223322322233333223133333322222233222212233333332222222222222222222222221333322222233332213232223332223444333333333332222222222222433333333213244333333333211222232422222221222332222212222211112111111111111111111111111111111111-111111111111111211111122111111111111111111111111111111121111111111111111111111111111111111111112222222111122121111112121112112221111111111111112111121111111111112312332222222222222223233333233322-112222211211111111222211222111121111111111111111111121111112122122222222223333334333-33333333333333333333332222222222222222222222222222321222222222222122122222111121112222222222222222111111111111111111111111111112222222221222211111111111111111111111111223333331111111111111111-11121111112211111113223222222211 1121443-73412232521243222232233133332223233222113233451133423233324333323333313334333323-572533333322343241523967346B2343352782828O517884311834774333351282654334944342555746232233G3412333852432365252 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 587 STR:RPRED 98.7 SQ:SECSTR ###cccccGGGccGGGTTcEEEEEEEEEEEEEccccEEEEEEETTEEEEEEEcGGGHHHHHHTTccTTcEEEEEEEEEEccTTTccTTcTTTTEEEEEEEEEEEEccccccccTTcTccccHHHHHHTHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHTTcEEcccccccccccccccccEEEccccTTcEEEcccccHHHHHHHHHTTccEEEEEEEEEccccccTTcccTEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccHHccccEEEHHHHHHHHccccccTTccccEEEcHHHHTTcccHHHHHHHHcTTEEEEEEETTGGGccHHHHHHHHHHHHHTTcccccEEEEccGGGGGGGEcTTGGGccHHHHHHHHHHTTccTTcEEEEEEEEHHHHHHHHHHHHHHHHHHTTccccccccEEEEEccccEEEEcccccEEEcccTTcccccccHHHHHHccTTccccEEEEEETTEEEEEEEEccccHHHHHHHHHHTTccHHHHHHHHHHHHHHTTTTcccEEEEEEEHHHHHHHHHTcccGGGGccccccTTcccTTTTccccccHHHHHHTTcccc##### DISOP:02AL 570-576, 591-595| PSIPRED ccccccccHHHccHHHcccEEEEEEEEEEEcccccEEEEEEEcccEEEEEEEEcccHHHHHHHHcccccEEEEccEEEEcccccccccccccEEEEEEEEEEEEEccccccccccccccccHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccEEEccccccccccEEEEEccccccEEEcccHHHHHHHHHHcccccEEEEEEEEEccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEHHHHHHHHccccccccccHHHHHHHHHHHHcccccccHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEEccccccccccHHHcccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccccccEEcccccEEcccccHHHcccccccEEEEEEEEEEcccEEEcccHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccEEccHHHHHHHHHcccccHHHcccccccccccccccccccccHHHHHHcccEEcccccc //