[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86958.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->150 PF06081 * DUF939 1.3e-07 21.2 132/141  
:BLT:SWISS 28->126 Y2769_CORGL 2e-04 23.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86958.1 GT:GENE AAK86958.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1146515..1146991 GB:FROM 1146515 GB:TO 1146991 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86958.1 GB:DB_XREF GI:15156192 LENGTH 158 SQ:AASEQ MLKTLLDRVRAAFTRALAAALAAAFAFWVAHRWLGHPQPVFAAISALICLSPGIPSHVRQGLGLMVGVTVGILVGEVALLVPHDFAEIRLASATFIAMILATLFGLPAVVPIQAGASAMLVLLMGPQIAGFVRFVDVIVGVAVGVVVALVFFRERLKL GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 28->126|Y2769_CORGL|2e-04|23.5|98/389| TM:NTM 5 TM:REGION 10->32| TM:REGION 36->58| TM:REGION 61->83| TM:REGION 96->118| TM:REGION 130->152| SEG 10->27|raaftralaaalaaafaf| SEG 130->152|gfvrfvdvivgvavgvvvalvff| HM:PFM:NREP 1 HM:PFM:REP 14->150|PF06081|1.3e-07|21.2|132/141|DUF939| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------11----------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 158-159| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccc //