[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86970.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:NRDR_AGRT5   RecName: Full=Transcriptional repressor nrdR;

Homologs  Archaea  4/68 : Bacteria  738/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.98.1g.41.3
:159 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->43 1i3qI2  g.41.3.1 * 1e-05 26.2 %
:RPS:SCOP  49->143 1r1rA1  a.98.1.1 * 4e-12 15.7 %
:RPS:PFM   49->132 PF03477 * ATP-cone 2e-10 42.9 %
:HMM:PFM   50->135 PF03477 * ATP-cone 1.6e-18 34.9 86/89  
:HMM:PFM   1->16 PF08271 * TF_Zn_Ribbon 0.00024 46.7 15/43  
:BLT:SWISS 1->159 NRDR_AGRT5 2e-88 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86970.1 GT:GENE AAK86970.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1161411..1161890 GB:FROM 1161411 GB:TO 1161890 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86970.1 GB:DB_XREF GI:15156206 LENGTH 159 SQ:AASEQ MRCPFCGSEDTQVKDSRPAEDNTSIRRRRICPDCGGRFTTYERVQLRELMVIKKSGRKLPFDREKLVRSFEIALRKRPVDRDRIERAVSGIARRLESSGETEIPSEEIGLQVLEALKSLDDVAFVRYASVYRDFSHAEDFENVIAEINAKIARDTDAGA GT:EXON 1|1-159:0| SW:ID NRDR_AGRT5 SW:DE RecName: Full=Transcriptional repressor nrdR; SW:GN Name=nrdR; OrderedLocusNames=Atu1166; ORFNames=AGR_C_2157; SW:KW ATP-binding; Complete proteome; DNA-binding; Metal-binding;Nucleotide-binding; Repressor; Transcription;Transcription regulation; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->159|NRDR_AGRT5|2e-88|100.0|159/159| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| RP:PFM:NREP 1 RP:PFM:REP 49->132|PF03477|2e-10|42.9|84/89|ATP-cone| HM:PFM:NREP 2 HM:PFM:REP 50->135|PF03477|1.6e-18|34.9|86/89|ATP-cone| HM:PFM:REP 1->16|PF08271|0.00024|46.7|15/43|TF_Zn_Ribbon| RP:SCP:NREP 2 RP:SCP:REP 2->43|1i3qI2|1e-05|26.2|42/73|g.41.3.1| RP:SCP:REP 49->143|1r1rA1|4e-12|15.7|89/218|a.98.1.1| OP:NHOMO 744 OP:NHOMOORG 742 OP:PATTERN ---------------------------1-111------------------------------------ 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111--111----------------------111111111111111-----------1111111111111111111111111111111---11111111111111111111-1111111111111111111111-11111111111111111111111111111111111111111111111111111111111---111111111111111111111111111-111111111111111111111111111111111111111111111111111-1111111-1-1111-11--1111111111-11111111111111111111111-11111111111-1111111-111111111111111111111111111111113111111111111-------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111----------1111111111111111--------------------------11111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111-1111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111---------111111111111111111111111111111-----------------1---------------------------11111-1111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 145-159| PSIPRED cccccccccccEEEEccccccccccHHHccccccccccccEEEEEEEccEEEEcccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccc //