[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86980.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->152 PF03981 * Ubiq_cyt_C_chap 7e-18 35.3 %
:HMM:PFM   35->175 PF03981 * Ubiq_cyt_C_chap 3e-46 45.0 140/143  
:BLT:SWISS 18->140 UQCC_XENLA 2e-04 19.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86980.2 GT:GENE AAK86980.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1170283..1170819 GB:FROM 1170283 GB:TO 1170819 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86980.2 GB:DB_XREF GI:159139948 LENGTH 178 SQ:AASEQ MIFGLFKKKNNNRAIVDRQYATLTAAARTPAFYLDLGVPDTVMGRFEMLSVIMILYFRRTKSSGVSGQEIAQEIVDAFFQDIDHSIRELGIGDQGVPKRMKKFAGMFYGRLESYAAALDASDCAALAAALRRNIYPQVDDEAPEMEGLAGWMMETSDALAAQSEETIATGSLTLPLPI GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 18->140|UQCC_XENLA|2e-04|19.5|123/200| SEG 115->130|aaaldasdcaalaaal| RP:PFM:NREP 1 RP:PFM:REP 37->152|PF03981|7e-18|35.3|116/145|Ubiq_cyt_C_chap| HM:PFM:NREP 1 HM:PFM:REP 35->175|PF03981|3e-46|45.0|140/143|Ubiq_cyt_C_chap| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111111111111111111111111-11111111111-111111111111111-1-----------------------111-------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7| PSIPRED ccccHHHHHHHcHHHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccc //