[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86988.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->39 PF06258 * DUF1022 0.00038 18.2 33/312  
:HMM:PFM   49->71 PF00975 * Thioesterase 0.00097 39.1 23/229  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86988.2 GT:GENE AAK86988.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1178871..1179104 GB:FROM 1178871 GB:TO 1179104 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86988.2 GB:DB_XREF GI:159139952 LENGTH 77 SQ:AASEQ MINPLVETFATVIAPHHSNPHKSTRIFPMTTNVNEMQSTLGKAIVLWKSGRNVSFAMATELREQGYDVAALAKAHRA GT:EXON 1|1-77:0| HM:PFM:NREP 2 HM:PFM:REP 7->39|PF06258|0.00038|18.2|33/312|DUF1022| HM:PFM:REP 49->71|PF00975|0.00097|39.1|23/229|Thioesterase| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,76-78| PSIPRED cccHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHccEEEEEEcccccHHHHHHHHHHccccHHHHHHHHcc //