[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86989.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->56 PF12042 * RP1-2 0.00023 27.1 48/168  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86989.1 GT:GENE AAK86989.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1179671..1179940 GB:FROM 1179671 GB:TO 1179940 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86989.1 GB:DB_XREF GI:15156229 LENGTH 89 SQ:AASEQ MAGTRTVTPIATAAATELGSDAIFGNPSADLASSGIKALSVFGQQAHGKRFSQADARNLARILPFQNLNGISQLLSTMISPLPEWSPKK GT:EXON 1|1-89:0| HM:PFM:NREP 1 HM:PFM:REP 9->56|PF12042|0.00023|27.1|48/168|RP1-2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 86-89| PSIPRED ccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccc //