[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86992.2
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->57 PF07195 * FliD_C 0.00025 28.2 39/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86992.2 GT:GENE AAK86992.2 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1181842..1182105 GB:FROM 1181842 GB:TO 1182105 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK86992.2 GB:DB_XREF GI:159139954 LENGTH 87 SQ:AASEQ MDDTQNFYLMFGRLEGKVDTLLSQQGGINKRIDDHDTLIDDHDTRITQLENQRERQVGILSSIRWGWVLLAAAIGTFSEEIKAWILR GT:EXON 1|1-87:0| TM:NTM 1 TM:REGION 56->78| SEG 31->47|riddhdtliddhdtrit| HM:PFM:NREP 1 HM:PFM:REP 19->57|PF07195|0.00025|28.2|39/239|FliD_C| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccEEEEEEEEcccHHHHHHHHHccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //