[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86993.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:196 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->191 2w82B PDBj 2e-08 30.5 %
:RPS:SCOP  75->152 2py6A1  c.66.1.56 * 2e-04 28.9 %
:RPS:PFM   4->190 PF07275 * ArdA 1e-10 35.5 %
:HMM:PFM   2->191 PF07275 * ArdA 4.7e-57 43.8 160/169  
:BLT:SWISS 51->130 THS1_HALVO 7e-04 37.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86993.1 GT:GENE AAK86993.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1182710..1183300 GB:FROM 1182710 GB:TO 1183300 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK86993.1 GB:DB_XREF GI:15156233 LENGTH 196 SQ:AASEQ MRFYAACLASYNNGVLHGRWIDASSDTDEMQEEVSAMLRASRFPNVMVKCPNCEGRLELCTVCDGGSREVPSAEEWAIHDYDGLPSSLGEYPGLDKIAAFVELCEEHDMTGEDMAAIVSHFGSVEYAKEELGNNFVGVHESFRAYAEELADEMLSAHDIKADHPLSQYFDYEAYARDLRHSASAVELDEGVAVFCV GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 51->130|THS1_HALVO|7e-04|37.2|78/560| BL:PDB:NREP 1 BL:PDB:REP 1->191|2w82B|2e-08|30.5|151/162| RP:PFM:NREP 1 RP:PFM:REP 4->190|PF07275|1e-10|35.5|155/167|ArdA| HM:PFM:NREP 1 HM:PFM:REP 2->191|PF07275|4.7e-57|43.8|160/169|ArdA| RP:SCP:NREP 1 RP:SCP:REP 75->152|2py6A1|2e-04|28.9|76/375|c.66.1.56| OP:NHOMO 23 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1-------------------------------------------------------------------------------------------------------------------------2---11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1212-------------------------------1---------1-------21-1--1-1-----------------1---------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 77.0 SQ:SECSTR cEEEEEEHHHHTTTcccEEEEEccccHHHHHHHHTcc#################################TTcccEEEEEEE#ccccccTTccHHHHHHHHHHHHHccHHHHTTHHHHHHcccHHHHHHTGGGEEEcHHHHHHHHHHTcc####TTccccTT##TGGGccHHHHHHHHHHTcEEEEETTEE##### PSIPRED cEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccHHHcccccEEcccEEEEccEEEEEEc //