[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK86996.2
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->113 2d1hB PDBj 1e-06 13.5 %
:RPS:SCOP  29->142 2ethA1  a.4.5.28 * 1e-07 21.7 %
:HMM:SCOP  1->113 1jgsA_ a.4.5.28 * 7.7e-10 26.7 %
:HMM:PFM   17->69 PF09339 * HTH_IclR 5.7e-06 28.2 39/52  
:BLT:SWISS 29->148 Y2019_BACC1 7e-04 27.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK86996.2 GT:GENE AAK86996.2 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1184274..1184741 GB:FROM 1184274 GB:TO 1184741 GB:DIRECTION + GB:PRODUCT transcriptional regulator, MarR family GB:PROTEIN_ID AAK86996.2 GB:DB_XREF GI:159139955 LENGTH 155 SQ:AASEQ MTTTTETTKRDAAFTVSRVINMLRTLSPDMPMQQADVLFQVVLYPGLTMADICKRTGLSQSSVSRNVSAMSKFHRLGKPGLDLVEAVIDPREPRRRLIFLTTHGKAFITKLLRNVDAEYSVDKETDARLEIERMHEEAMAKEETSSTRGRAKRPQ GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 29->148|Y2019_BACC1|7e-04|27.5|109/147| SEG 2->8|ttttett| RP:PDB:NREP 1 RP:PDB:REP 16->113|2d1hB|1e-06|13.5|89/96| HM:PFM:NREP 1 HM:PFM:REP 17->69|PF09339|5.7e-06|28.2|39/52|HTH_IclR| RP:SCP:NREP 1 RP:SCP:REP 29->142|2ethA1|1e-07|21.7|106/140|a.4.5.28| HM:SCP:REP 1->113|1jgsA_|7.7e-10|26.7|105/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 117 STR:RPRED 75.5 SQ:SECSTR ###############TTTTHHHHHHHH#TccHHHHHHHHHHHHTccccHHHHHHHHTccHHHHHHHHHHHHHEEEcccccTTcEEEEEcccEEEEEcTTHHHHHHHHHHHHHHHTTTcHHTTTccHHHHHHHH###################### DISOP:02AL 1-2,138-156| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHccccccccccEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //