[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87008.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  46/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->100 PF10115 * HlyU 8e-21 59.8 %
:HMM:PFM   3->100 PF10115 * HlyU 2.5e-35 52.2 90/91  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87008.2 GT:GENE AAK87008.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1199961..1200272 GB:FROM 1199961 GB:TO 1200272 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87008.2 GB:DB_XREF GI:159139960 LENGTH 103 SQ:AASEQ MASFFSKILSAFGSGQPSSDAPQKVAQAEPHAHGDYLIYATPIKEGGQFRLAGRIEKKAGDEVLVHEFVRADVFTSLDDAVEFTIRKAKLIIDQNGASLFPGK GT:EXON 1|1-103:0| RP:PFM:NREP 1 RP:PFM:REP 1->100|PF10115|8e-21|59.8|92/92|HlyU| HM:PFM:NREP 1 HM:PFM:REP 3->100|PF10115|2.5e-35|52.2|90/91|HlyU| OP:NHOMO 46 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111---------11--111111111111------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------1------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,11-29,102-104| PSIPRED cHHHHHHHHHHccccccccccccccccccEEEEccEEEEEcccccccEEEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccc //