[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87011.1
DDBJ      :             transcriptional regulator, LysR family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  571/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:322 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->270 3hhgG PDBj 6e-13 27.8 %
:RPS:PDB   4->206 1b9nB PDBj 2e-23 11.9 %
:RPS:SCOP  1->104 1b9mA1  a.4.5.8 * 5e-21 17.5 %
:RPS:SCOP  92->298 1i69A  c.94.1.1 * 3e-16 18.2 %
:HMM:SCOP  5->94 1ixcA1 a.4.5.37 * 3.9e-22 49.4 %
:HMM:SCOP  87->303 1uthA_ c.94.1.1 * 3.7e-27 25.9 %
:RPS:PFM   7->66 PF00126 * HTH_1 4e-07 55.9 %
:RPS:PFM   114->281 PF03466 * LysR_substrate 5e-07 29.5 %
:HMM:PFM   92->296 PF03466 * LysR_substrate 9.3e-31 24.8 202/209  
:HMM:PFM   7->67 PF00126 * HTH_1 2.8e-23 51.7 60/60  
:BLT:SWISS 5->287 YEEY_ECOLI 3e-22 27.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87011.1 GT:GENE AAK87011.1 GT:PRODUCT transcriptional regulator, LysR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1202563..1203531 GB:FROM 1202563 GB:TO 1203531 GB:DIRECTION + GB:PRODUCT transcriptional regulator, LysR family GB:PROTEIN_ID AAK87011.1 GB:DB_XREF GI:15156255 LENGTH 322 SQ:AASEQ MDANPTLDQLQVFLTVAETGSFSAAARALNRAQSVVSYTIANLEAQLEVVLFERNGVRQPKLTDEGRAMLEDARRIVAGLQEMRARAKGLKQGLEAELSVAISTMVPAEAVVAVLRDFREQFPTVTLSLNVGELGMVMDMVLSRKAGIGIGGAVLRQDDDLVMEKVGHSFMLPVVAADHPLAQIERPLVLADVREEVQLVVTDASGLTKGRDFNVLSYKTWRVSDIATKYQLIKGGLGWGGLPASIVRNDLTNGSLKALELEAYEQGEYPLFTLRRVDSPAGPAGQWLAQAFQERLSACPNHKDFNGMLEASKQRTMAVAAE GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 5->287|YEEY_ECOLI|3e-22|27.9|280/309| BL:PDB:NREP 1 BL:PDB:REP 8->270|3hhgG|6e-13|27.8|255/294| RP:PDB:NREP 1 RP:PDB:REP 4->206|1b9nB|2e-23|11.9|194/245| RP:PFM:NREP 2 RP:PFM:REP 7->66|PF00126|4e-07|55.9|59/60|HTH_1| RP:PFM:REP 114->281|PF03466|5e-07|29.5|166/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 92->296|PF03466|9.3e-31|24.8|202/209|LysR_substrate| HM:PFM:REP 7->67|PF00126|2.8e-23|51.7|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->104|1b9mA1|5e-21|17.5|103/122|a.4.5.8| RP:SCP:REP 92->298|1i69A|3e-16|18.2|203/206|c.94.1.1| HM:SCP:REP 5->94|1ixcA1|3.9e-22|49.4|89/0|a.4.5.37|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 87->303|1uthA_|3.7e-27|25.9|212/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 4065 OP:NHOMOORG 579 OP:PATTERN -----------------------1-----------------------------1-------------- 221-2---1112-1111----111-4----------25D9-1--21---11-1321-2---2--1282552---------1-21111-11-1-------------1---1--------------------------23312----14224444342211111132265232111111111111-1------2284444435413323533-886A64724251--122221DH---------------3221---1-11----------1-2---1------------------------------------------------12323333323-32-111-11131---3-11156431-1-6-1111----1-422311---42A9E6245636455545565469-555559486G1-HAA6AB6JFEDG8A42326A22235695555555525744233------------------------------196228WQGOTcbacWAHHIGQQTSJJIIBGaMZJORQ--IEE85994QAI4I68G64335B62233213443387521121311-6222-31222313-223257-2-------------------------87B6A434G489599AA968ABA99ABAC9GF1--1347------HD6B5DADDDDDDCDDD-CDCDEDBDCCCDECDBEDDIOK9A47BC7ECDDFDECBCECCAI99AAAA82-855555555555---1-1---212234D9K111313-22221223DCDDD97225C5KLKLIPRRHLPOO6DBD---------4389M66666DEG778778B873422111----11------------1-------------------------------------13- --------------------------------------------------------------------------------------------------------------------------------------------------------------2----2---------1-1------------4-----3---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 300 STR:RPRED 93.2 SQ:SECSTR ccHEEcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTcccccccccHcEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTcTTTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEEEEEcGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTcEEccHHHTcccEEEEEEccHHHHHHHHHHTccEEEEEGGGccHTTTcTTcEEEEccTTTcccEEEEEEEETTccccHHHHHHHHHHcTTccHHH###################### DISOP:02AL 1-3, 89-92, 304-322| PSIPRED ccccccHHHHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHccEEEEEccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccEEEEEEEccccccccEEEEEEccccEEEEEcccccHHHccccccHHHHHHccEEEEcccccccHHHHHccccccEEEEccHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEEccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHccc //