[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87013.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.2
:111 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  10->94 1ywuA1  b.45.2.1 * 1e-09 14.1 %
:HMM:SCOP  10->98 1ywuA1 b.45.2.1 * 7.7e-07 24.7 %
:HMM:PFM   10->97 PF07238 * PilZ 4.1e-13 20.5 88/102  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87013.2 GT:GENE AAK87013.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1205899..1206234) GB:FROM 1205899 GB:TO 1206234 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87013.2 GB:DB_XREF GI:159140680 LENGTH 111 SQ:AASEQ MTNNLNMATRSAARSKTRIFATVFYFSQSTRGRVVDLSATGMALELDGPFAAAKGSRVKVQSDDLGFIEGVVQWQHQNRLGLQLKLSTNTLAQLTSYFRFFHEEVKPTLAR GT:EXON 1|1-111:0| HM:PFM:NREP 1 HM:PFM:REP 10->97|PF07238|4.1e-13|20.5|88/102|PilZ| RP:SCP:NREP 1 RP:SCP:REP 10->94|1ywuA1|1e-09|14.1|85/125|b.45.2.1| HM:SCP:REP 10->98|1ywuA1|7.7e-07|24.7|89/0|b.45.2.1|1/1|PilZ domain-like| OP:NHOMO 13 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111311111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14,109-112| PSIPRED cccccccHHHHccccEEEEEEEEEEEEccccEEEEEEccccEEEEEEcccccccccEEEEEEHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHccc //