[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87016.2
DDBJ      :             DNA-binding protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.71.1
:214 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   127->185 2gd9B PDBj 4e-07 37.9 %
:RPS:PDB   1->193 3dgaB PDBj 6e-20 11.6 %
:RPS:SCOP  1->193 1j3iA  c.71.1.1 * 3e-22 10.5 %
:HMM:SCOP  2->214 2b3zA1 c.71.1.2 * 3.5e-27 27.3 %
:RPS:PFM   105->193 PF01872 * RibD_C 4e-09 38.2 %
:HMM:PFM   5->201 PF01872 * RibD_C 1.8e-24 25.2 159/200  
:BLT:SWISS 127->185 YYAP_BACSU 1e-06 37.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87016.2 GT:GENE AAK87016.2 GT:PRODUCT DNA-binding protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1207901..1208545 GB:FROM 1207901 GB:TO 1208545 GB:DIRECTION + GB:PRODUCT DNA-binding protein GB:PROTEIN_ID AAK87016.2 GB:DB_XREF GI:159139964 LENGTH 214 SQ:AASEQ MPKVVVRNFAISLDGYGAGPDQSLQNPLGVKGEELHQWAFKTRTFHRMFGKEGGSTGTDENFSEKSFENIGAWVLGRNMFGPVRGAWPDESWKGWWGEEPPYHVPVFVLTHHARPSFTMKGGTEFHFVTDGIEAALDRALTAANGKDVRIGGGVSTIRQYMAAGMIDELHLALAPVFLGKGEQLFEGLDLPALGYRCTGTVAGEGATHLIIEKV GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 127->185|YYAP_BACSU|1e-06|37.9|58/188| BL:PDB:NREP 1 BL:PDB:REP 127->185|2gd9B|4e-07|37.9|58/167| RP:PDB:NREP 1 RP:PDB:REP 1->193|3dgaB|6e-20|11.6|172/224| RP:PFM:NREP 1 RP:PFM:REP 105->193|PF01872|4e-09|38.2|89/198|RibD_C| HM:PFM:NREP 1 HM:PFM:REP 5->201|PF01872|1.8e-24|25.2|159/200|RibD_C| GO:PFM:NREP 2 GO:PFM GO:0008703|"GO:5-amino-6-(5-phosphoribosylamino)uracil reductase activity"|PF01872|IPR002734| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF01872|IPR002734| RP:SCP:NREP 1 RP:SCP:REP 1->193|1j3iA|3e-22|10.5|171/223|c.71.1.1| HM:SCP:REP 2->214|2b3zA1|3.5e-27|27.3|183/0|c.71.1.2|1/1|Dihydrofolate reductase-like| OP:NHOMO 76 OP:NHOMOORG 61 OP:PATTERN --------------------------------------------1----------------------- -1--2--------------------1------11112132-1-212-1----211--1--122-1---11-------------------------------------1-----------------------------11-----------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---2------1---11-12-21111---------------------------------------------------------------1--------------------1---------1-1-1--11---------12--------1------------1-1-----------------------1121-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 99.5 SQ:SECSTR cccTTcEcccGGGccEEEEcTTccccccccHHHHHHHHHHHHHcccGGGHHHHHHHHHTccccccccccEEEEEEEHHHHHTccGGGcGGGccGGGcccccTTEEEEEEcccccccccccccccEcEEEccGGGHHHHHHHTccEEEEEEcccHHHHHHHHHTTcccEEEEEEEEEEEccccEEcccccTTTEGEEEccHHHHHHHHTTcccc# PSIPRED ccEEEEEEEEEEEEEEEEccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHccEEEEEcccHHHHHccccccccccccccccccccEEEEEEcccccccccccccEEEEEccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHcccccEEEEEEEEEEEcccEEcccccccccccEEEEEEEccccEEEEEEEEc //