[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87021.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:98 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->87 PF06169 * DUF982 9e-11 42.5 %
:HMM:PFM   14->88 PF06169 * DUF982 1.7e-27 50.7 75/76  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87021.1 GT:GENE AAK87021.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1213726..1214022 GB:FROM 1213726 GB:TO 1214022 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87021.1 GB:DB_XREF GI:15156267 LENGTH 98 SQ:AASEQ MEVQSMLLNDVKWEKPVTISLQNGAPRIFNGVYEAFDFLQHEWPARGDRAHEQALRLCRASLMGDVAGEIARTAFVAASRQAHCLMEDKAEAPNTIAS GT:EXON 1|1-98:0| RP:PFM:NREP 1 RP:PFM:REP 15->87|PF06169|9e-11|42.5|73/76|DUF982| HM:PFM:NREP 1 HM:PFM:REP 14->88|PF06169|1.7e-27|50.7|75/76|DUF982| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHccccccccEEEEcccccEEEEEcHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHcc //