[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87030.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:225 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   130->182 PF02362 * B3 0.00024 23.9 46/96  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87030.1 GT:GENE AAK87030.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1222035..1222712) GB:FROM 1222035 GB:TO 1222712 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAK87030.1 GB:DB_XREF GI:15156278 LENGTH 225 SQ:AASEQ MMRIARSWTQLVMVSSIDLSTRLTATRLALKAIKEQEDSSVAQSSSTRTALLGSYGLDSSSSTNTRLTQLLAQYDQASGDDTQTEVTDMQPSSGDITKADFMKGLKGMLEELSKDPDKASQANAMLEALKAGTLTVSDPADGLQIKAWDVASDTETTSKPSIEITTTGWSDFLKEHLKRDGSTYAKGASGAYVDTISGDNAFFGSVGSRYYYLTWPQAKNGSLTI GT:EXON 1|1-225:0| SEG 21->30|trltatrlal| SEG 51->62|llgsygldssss| HM:PFM:NREP 1 HM:PFM:REP 130->182|PF02362|0.00024|23.9|46/96|B3| OP:NHOMO 7 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------22-11--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 34-48, 77-94, 223-225| PSIPRED cccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHccccccccEEEccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccEEEEcccccccEEEEEcccccccccccccEEEccccHHHHHHHHHHcccccccccccccEEEEcccccEEEEEEccEEEEEEccccccccccc //