[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87038.2
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   37->63 PF11003 * DUF2842 4e-04 59.3 %
:HMM:PFM   6->65 PF11003 * DUF2842 2.1e-24 45.0 60/62  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87038.2 GT:GENE AAK87038.2 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1231639..1231851) GB:FROM 1231639 GB:TO 1231851 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87038.2 GB:DB_XREF GI:159139973 LENGTH 70 SQ:AASEQ MHPRLRSLIGTVVIICLVVIYAVAATAIASATLAQSPWWVHLAYFVLSGVLWILPAMLIIKWMAGSKKQG GT:EXON 1|1-70:0| TM:NTM 2 TM:REGION 9->31| TM:REGION 42->64| SEG 17->34|lvviyavaataiasatla| RP:PFM:NREP 1 RP:PFM:REP 37->63|PF11003|4e-04|59.3|27/62|DUF2842| HM:PFM:NREP 1 HM:PFM:REP 6->65|PF11003|2.1e-24|45.0|60/62|DUF2842| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,67-71| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //