[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87068.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   38->66 PF10879 * DUF2674 0.00028 34.5 29/67  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87068.1 GT:GENE AAK87068.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1259401..1259661 GB:FROM 1259401 GB:TO 1259661 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87068.1 GB:DB_XREF GI:15156322 LENGTH 86 SQ:AASEQ MRLPLAIPAFLAAMSTPVLAQTATDEGGVSLSGGGSSTIKQLLSSGYEIKASVPNGSKFIVFMQKDKAAYACEFVTVARSRCETLN GT:EXON 1|1-86:0| SEG 27->37|ggvslsgggss| HM:PFM:NREP 1 HM:PFM:REP 38->66|PF10879|0.00028|34.5|29/67|DUF2674| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 20-35, 84-86| PSIPRED ccccHHHHHHHHHHcccHHHHHccccccEEEEcccHHHHHHHHHcccEEEEEcccccEEEEEEEcccccEEEHHHEEEHHHccccc //