[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87092.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:228 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->184 2dhoA PDBj 5e-05 15.4 %
:RPS:SCOP  14->196 1x51A1  d.113.1.3 * 1e-06 13.1 %
:HMM:SCOP  20->205 1f3yA_ d.113.1.1 * 5.5e-19 30.4 %
:RPS:PFM   26->181 PF00293 * NUDIX 5e-05 38.1 %
:HMM:PFM   23->197 PF00293 * NUDIX 1.4e-23 34.4 131/135  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87092.1 GT:GENE AAK87092.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION complement(1290517..1291203) GB:FROM 1290517 GB:TO 1291203 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAK87092.1 GB:DB_XREF GI:15156352 LENGTH 228 SQ:AASEQ MGRTLHEPQRARDAETVNAPLRPRDAASLILFDRSGPQLRVLMGQRSNAHVFMPGAYVFPGGKRDPRDHALPFSGDLHPAVLRSLTASAARRLSAAGARALALAAARELFEETGVDLGLGAGGPDLSRFRYVARAITPPGNVRRYDTRFFCCYSDELGLDVRLTRDSDELSNVQWLDMTDLSGLNMPKITRTVLEDVTKLMIGDPSLPFESPARLYVTRHGRFIREFV GT:EXON 1|1-228:0| SEG 80->107|avlrsltasaarrlsaagaralalaaar| RP:PDB:NREP 1 RP:PDB:REP 3->184|2dhoA|5e-05|15.4|143/215| RP:PFM:NREP 1 RP:PFM:REP 26->181|PF00293|5e-05|38.1|113/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 23->197|PF00293|1.4e-23|34.4|131/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 14->196|1x51A1|1e-06|13.1|137/142|d.113.1.3| HM:SCP:REP 20->205|1f3yA_|5.5e-19|30.4|138/0|d.113.1.1|1/1|Nudix| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------1111-11111111111111111-111111--111--11---1---111111111-1-11111--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 169 STR:RPRED 74.1 SQ:SECSTR ##EEEEEEHHHHTcHHHHTTTccEEEEEEEEEcTTccE#cEEEEEEcTTccccTccccHHHHccGGGHHHH############################cHHHHHHHHHHHHHcccGGGccGGGcEEEEEEEEEEEcccccEEEEEEEEEEEEccccEEcccccccTTTEEEEEEEcHHHHHHHHHHHTTcHHHHHHHTT############################ DISOP:02AL 1-21| PSIPRED ccHHHHHHHHHcccccccccccccccEEEEEEEccccccEEEEEEEccccccccccEEccccccccccccccccccccccccccccccccccccccccHHEEHHHHHHHHHHccEEEEcccccccHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccEEEEEcHHHHHccccccHHHHHHHHHHHHHHccccccccccEEEEEEEccEEEEEEc //