[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Agrobacterium tumefaciens str. C58 (atum0)
Chromosome : circular
Gene : AAK87105.2
DDBJ      :             transcriptional regulator, TetR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->138 2g3bB PDBj 2e-06 33.9 %
:RPS:PDB   20->211 2dg7A PDBj 7e-16 15.5 %
:RPS:SCOP  18->87 2iu5A1  a.4.1.9 * 8e-12 18.6 %
:RPS:SCOP  101->185 2g3bA2  a.121.1.1 * 6e-06 8.4 %
:HMM:SCOP  17->93 2gfnA1 a.4.1.9 * 1.1e-13 27.3 %
:HMM:SCOP  97->216 1pb6A2 a.121.1.1 * 5.6e-09 24.8 %
:RPS:PFM   27->73 PF00440 * TetR_N 2e-05 38.3 %
:HMM:PFM   27->73 PF00440 * TetR_N 2.5e-14 34.0 47/47  
:BLT:SWISS 27->191 Y1255_MYCTU 1e-06 29.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAK87105.2 GT:GENE AAK87105.2 GT:PRODUCT transcriptional regulator, TetR family GT:DATABASE GIB00072CH01 GT:ORG atum0 GB:ACCESSION GIB00072CH01 GB:CHROMOSOME circular GB:LOCATION 1305536..1306180 GB:FROM 1305536 GB:TO 1306180 GB:DIRECTION + GB:PRODUCT transcriptional regulator, TetR family GB:PROTEIN_ID AAK87105.2 GB:DB_XREF GI:159139994 LENGTH 214 SQ:AASEQ MLATAEAISADRPEKRIKDRAQTEKAIFNAARTLLAEEGFQGFGINAVARRAGCDKQLIYRYFGGLDGLIEAIGEDLGSWVKDRIPEDTGGMFLLTYGDLMEKLALYFIDALRSDPLVCKIIAWEVSDGSPQVRQLAEARAKSLGKWLERMRGSLAAPKGVDTAAVNAVLFAAIQHLVISAATSGQFAGVPLKSDKDWDKITTAVKRLVRGVYG GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 27->191|Y1255_MYCTU|1e-06|29.9|157/202| BL:PDB:NREP 1 BL:PDB:REP 21->138|2g3bB|2e-06|33.9|115/186| RP:PDB:NREP 1 RP:PDB:REP 20->211|2dg7A|7e-16|15.5|181/185| RP:PFM:NREP 1 RP:PFM:REP 27->73|PF00440|2e-05|38.3|47/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 27->73|PF00440|2.5e-14|34.0|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 18->87|2iu5A1|8e-12|18.6|70/71|a.4.1.9| RP:SCP:REP 101->185|2g3bA2|6e-06|8.4|83/116|a.121.1.1| HM:SCP:REP 17->93|2gfnA1|1.1e-13|27.3|77/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 97->216|1pb6A2|5.6e-09|24.8|117/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------1-111-11-111-----------1-1------------------------------------------------------1-----------------------------------------------1-----------------------1-------21--------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 98.6 SQ:SECSTR ##HHHHHHHcTcccccccccTTHHHHHHHHHHHHHHHccGGGccHHHHHHHTTccHHHHHHHcccTTGGGTTTccccHHHHHHHHTccTTccHHccHHHHHHHHHHHTTTTTTccTTHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHTTTHHTTcccHHHHHHHHHHHHHHHHHcTc# DISOP:02AL 1-26| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHcc //